default search action

combined dblp search
author search
venue search
publication search

ask others

ChengXiang Zhai

Chengxiang Zhai – Cheng-Xiang Zhai – Cheng Xiang Zhai

> Home > Persons

Person information

affiliation: University of Illinois Urbana-Champaign, IL, USA

Refine list

refinements active!

zoomed in on ?? of ?? records

view refined list in

export refined list as

showing all ?? records

2020 – today

see FAQ

What is the meaning of the colors in the publication lists?

2025
[c343]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/coling/SunYR0CSZJ25
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/SunYR0CSZJ25
Chenkai Sun, Ke Yang, Revanth Gangi Reddy, Yi Ren Fung, Hou Pong Chan, Kevin Small, ChengXiang Zhai, Heng Ji:
Persona-DB: Efficient Large Language Model Personalization for Response Prediction with Collaborative Data Refinement. COLING 2025: 281-296
2024
[j69]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/frai/MannekoteDPZOSLZZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/frai/MannekoteDPZOSLZZ24
Amogh Mannekote, Adam Davies, Juan D. Pinto, Shan Zhang, Daniel Olds, Noah L. Schroeder, Blair Lehman, Diego Zapata-Rivera, Chengxiang Zhai:
Large language models for whole-learner support: opportunities and challenges. Frontiers Artif. Intell. 7 (2024)
[j68]
- view
  authority control:
- export record
  dblp key:
  - journals/ftir/BalogZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ftir/BalogZ24
Krisztian Balog, ChengXiang Zhai:
User Simulation for Evaluating Information Access Systems. Found. Trends Inf. Retr. 18(1-2): 1-261 (2024)
[j67]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/jocss/ZhangDZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jocss/ZhangDZ24
Yu Zhang, Adam Davies, ChengXiang Zhai:
Understanding the social construction of juvenile delinquency: insights from semantic analysis of big-data historical newspaper collections. J. Comput. Soc. Sci. 7(2): 1095-1137 (2024)
[c342]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/0044ZS00SZ024
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/0044ZS00SZ024
Yu Zhang, Yunyi Zhang, Yanzhen Shen, Yu Deng, Lucian Popa, Larisa Shwartz, ChengXiang Zhai, Jiawei Han:
Seed-Guided Fine-Grained Entity Typing in Science and Engineering Domains. AAAI 2024: 19606-19614
[c341]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/eacl/BhavyaSXZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eacl/BhavyaSXZ24
Bhavya, Shradha Sehgal, Jinjun Xiong, ChengXiang Zhai:
AnaDE1.0: A Novel Data Set for Benchmarking Analogy Detection and Extraction. EACL (1) 2024: 1723-1737
[c340]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/edm/SehgalBDMZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/edm/SehgalBDMZ24
Shradha Sehgal, Bhavya, Krishna Phani Datta, Aditi Mallavarapu, ChengXiang Zhai:
Exploring AI-powered Multimodal Analogies for Science Education. HEXED/L3MNGET@EDM 2024
[c339]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/emnlp/PiWJZTZNH24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/PiWJZTZNH24
Xinyu Pi, Mingyuan Wu, Jize Jiang, Haozhen Zheng, Beitong Tian, ChengXiang Zhai, Klara Nahrstedt, Zhiting Hu:
UOUO: Uncontextualized Uncommon Objects for Measuring Knowledge Horizons of Vision Language Models. EMNLP 2024: 6432-6441
[c338]
- view
  authority control:
- export record
  dblp key:
  - conf/sigcse/RosZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigcse/RosZ24
Kevin Ros, ChengXiang Zhai:
Scaling Collaborative Learning: Using the Community Digital Library to Enrich Course Content. SIGCSE (2) 2024: 1798-1799
[c337]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Zhai24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Zhai24
ChengXiang Zhai:
Large Language Models and Future of Information Retrieval: Opportunities and Challenges. SIGIR 2024: 481-490
[c336]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/RosTPJZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/RosTPJZ24
Kevin Ros, Kedar Takwane, Ashwin Patil, Rakshana Jayaprakash, ChengXiang Zhai:
TextData: Save What You Know and Find What You Don't. SIGIR 2024: 2806-2810
[c335]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/ReddySBYSASZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/ReddySBYSASZ24
Revanth Gangi Reddy, Sharath Chandra Etagi Suresh, Hao Bai, Wentao Yao, Mankeerat Sidhu, Karan Aggarwal, Prathamesh Sonawane, ChengXiang Zhai:
CharmBana: Progressive Responses with Real-Time Internet Search for Knowledge-Powered Conversations. WSDM 2024: 1050-1053
[c334]
- view
  authority control:
- export record
  dblp key:
  - conf/www/BalogZ24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/BalogZ24
Krisztian Balog, ChengXiang Zhai:
Tutorial on User Simulation for Evaluating Information Access Systems on the Web. WWW (Companion Volume) 2024: 1254-1257
[i56]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2401-00812
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2401-00812
Ke Yang, Jiateng Liu, John Wu, Chaoqi Yang, Yi R. Fung, Sha Li, Zixuan Huang, Xu Cao, Xingyao Wang, Yiquan Wang, Heng Ji, Chengxiang Zhai:
If LLM Is the Wizard, Then Code Is the Wand: A Survey on How Code Empowers Large Language Models to Serve as Intelligent Agents. CoRR abs/2401.00812 (2024)
[i55]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2401-13129
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2401-13129
Yu Zhang, Yunyi Zhang, Yanzhen Shen, Yu Deng, Lucian Popa, Larisa Shwartz, ChengXiang Zhai, Jiawei Han:
Seed-Guided Fine-Grained Entity Typing in Science and Engineering Domains. CoRR abs/2401.13129 (2024)
[i54]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2402-11060
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2402-11060
Chenkai Sun, Ke Yang, Revanth Gangi Reddy, Yi R. Fung, Hou Pong Chan, ChengXiang Zhai, Heng Ji:
Persona-DB: Efficient Large Language Model Personalization for Response Prediction with Collaborative Data Refinement. CoRR abs/2402.11060 (2024)
[i53]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2402-15481
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2402-15481
Yiran Liu, Ke Yang, Zehan Qi, Xiao Liu, Yang Yu, Chengxiang Zhai:
Prejudice and Caprice: A Statistical Framework for Measuring Social Discrimination in Large Language Models. CoRR abs/2402.15481 (2024)
[i52]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2406-00247
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2406-00247
Navid Mehrdad, Hrushikesh Mohapatra, Mossaab Bagdouri, Prijith Chandran, Alessandro Magnani, Xunfan Cai, Ajit Puthenputhussery, Sachin Yadav, Tony Lee, ChengXiang Zhai, Ciya Liao:
Large Language Models for Relevance Judgment in Product Search. CoRR abs/2406.00247 (2024)
[i51]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2407-18391
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2407-18391
Xinyu Pi, Mingyuan Wu, Jize Jiang, Haozhen Zheng, Beitong Tian, Chengxiang Zhai, Klara Nahrstedt, Zhiting Hu:
UOUO: Uncontextualized Uncommon Objects for Measuring Knowledge Horizons of Vision Language Models. CoRR abs/2407.18391 (2024)
[i50]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2411-16454
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2411-16454
Xiaocong Yang, Jiacheng Lin, Ziqi Wang, Chengxiang Zhai:
Learning by Analogy: Enhancing Few-Shot Prompting for Math Word Problem Solving with Computational Graph-Based Retrieval. CoRR abs/2411.16454 (2024)
[i49]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2412-12157
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2412-12157
Jia-Yu Liu, Zhenya Huang, Chaokun Wang, Xunpeng Huang, Chengxiang Zhai, Enhong Chen:
What Makes In-context Learning Effective for Mathematical Reasoning: A Theoretical Analysis. CoRR abs/2412.12157 (2024)
[i48]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2412-14436
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2412-14436
Eric Modesitt, Ke Yang, Spencer Hulsey, Chengxiang Zhai, Volodymyr V. Kindratenko:
ORBIT: Cost-Effective Dataset Curation for Large Language Model Domain Adaptation with an Astronomy Case Study. CoRR abs/2412.14436 (2024)
2023
[j66]
- view
  authority control:
- export record
  dblp key:
  - journals/jbi/LaiZJ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jbi/LaiZJ23
Tuan Manh Lai, ChengXiang Zhai, Heng Ji:
KEBLM: Knowledge-Enhanced Biomedical Language Models. J. Biomed. Informatics 143: 104392 (2023)
[c333]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/LiuHZ023
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/LiuHZ023
Jiayu Liu, Zhenya Huang, ChengXiang Zhai, Qi Liu:
Learning by Applying: A General Framework for Mathematical Reasoning via Enhancing Explicit Knowledge Learning. AAAI 2023: 4497-4506
[c332]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/SunLCZJ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/SunLCZJ23
Chenkai Sun, Jinning Li, Hou Pong Chan, ChengXiang Zhai, Heng Ji:
Measuring the Effect of Influential Messages on Varying Personas. ACL (2) 2023: 554-562
[c331]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/PeiJCZ023
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/PeiJCZ023
Kevin Pei, Ishan Jindal, Kevin Chen-Chuan Chang, ChengXiang Zhai, Yunyao Li:
When to Use What: An In-Depth Comparative Empirical Analysis of OpenIE Systems for Downstream Applications. ACL (1) 2023: 929-949
[c330]
- view
  authority control:
- export record
  dblp key:
  - conf/bcb/SarkerZHZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bcb/SarkerZHZ23
Kowshika Sarker, Ruoqing Zhu, Hannah D. Holscher, ChengXiang Zhai:
Augmenting nutritional metabolomics with a genome-scale metabolic model for assessment of diet intake. BCB 2023: 4:1-4:10
[c329]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/BalogZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/BalogZ23
Krisztian Balog, ChengXiang Zhai:
Tutorial on User Simulation for Evaluating Information Access Systems. CIKM 2023: 5200-5203
[c328]
- view
  authority control:
- export record
  dblp key:
  - conf/cscw/RosZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cscw/RosZ23
Kevin Ros, ChengXiang Zhai:
The CDL: An Online Platform for Creating Community-based Digital Libraries. CSCW Companion 2023: 372-375
[c327]
- view
  authority control:
- export record
  dblp key:
  - conf/eacl/SunXZJ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eacl/SunXZJ23
Chenkai Sun, Tie Xu, Chengxiang Zhai, Heng Ji:
Incorporating Task-Specific Concept Knowledge into Script Learning. EACL 2023: 3018-3032
[c326]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/SunL0CAZJ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/SunL0CAZJ23
Chenkai Sun, Jinning Li, Yi Ren Fung, Hou Pong Chan, Tarek F. Abdelzaher, ChengXiang Zhai, Heng Ji:
Decoding the Silent Majority: Inducing Belief Augmented Social Graph with Large Language Model for Response Forecasting. EMNLP 2023: 43-57
[c325]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ReddyBYSJZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ReddyBYSJZ23
Revanth Gangi Reddy, Hao Bai, Wentao Yao, Sharath Chandra Etagi Suresh, Heng Ji, ChengXiang Zhai:
Social Commonsense-Guided Search Query Generation for Open-Domain Knowledge-Powered Conversations. EMNLP (Findings) 2023: 873-885
[c324]
- view
  authority control:
- export record
  dblp key:
  - conf/icdm/LiZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icdm/LiZ23
Yifan Li, ChengXiang Zhai:
An Exploration of Large Language Models for Verification of News Headlines. ICDM (Workshops) 2023: 197-206
[c323]
- view
  authority control:
- export record
  dblp key:
  - conf/icdm/BhavyaI0NASZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icdm/BhavyaI0NASZ23
Bhavya, Paulina Toro Isaza, Yu Deng, Michael Nidd, Amar Prakash Azad, Larisa Shwartz, ChengXiang Zhai:
Exploring Large Language Models for Low-Resource IT Information Extraction. ICDM (Workshops) 2023: 1203-1212
[c322]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/RosJLZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/RosJLZ23
Kevin Ros, Matthew Jin, Jacob Levine, ChengXiang Zhai:
Retrieving Webpages Using Online Discussions. ICTIR 2023: 159-168
[c321]
- view
  - electronic edition @ nips.cc (open access)
  - details & citations
- export record
  dblp key:
  - conf/nips/RenLWXZZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nips/RenLWXZZ23
Liliang Ren, Yang Liu, Shuohang Wang, Yichong Xu, Chenguang Zhu, ChengXiang Zhai:
Sparse Modular Activation for Efficient Sequence Modeling. NeurIPS 2023
[c320]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir-ap/BalogZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir-ap/BalogZ23
Krisztian Balog, ChengXiang Zhai:
Rethinking Conversational Agents in the Era of LLMs: Proactivity, Non-collaborativity, and Beyond. SIGIR-AP 2023: 302-305
[c319]
- view
  authority control:
- export record
  dblp key:
  - conf/sustainlp/CamposMKZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sustainlp/CamposMKZ23
Daniel Campos, Alexandre Marques, Mark Kurtz, ChengXiang Zhai:
oBERTa: Improving Sparse Transfer Learning via improved initialization, distillation, and pruning regimes. SustaiNLP 2023: 39-58
[c318]
- view
  authority control:
- export record
  dblp key:
  - conf/sustainlp/CamposMZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sustainlp/CamposMZ23
Daniel Campos, Alessandro Magnani, Chengxiang Zhai:
Quick Dense Retrievers Consume KALE: Post Training KullbackLeibler Alignment of Embeddings for Asymmetrical dual encoders. SustaiNLP 2023: 59-77
[c317]
- view
  authority control:
- export record
  dblp key:
  - conf/sustainlp/CamposZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sustainlp/CamposZ23
Daniel Campos, Chengxiang Zhai:
To Asymmetry and Beyond: Structured Pruning of Sequence to Sequence Models for Improved Inference Efficiency. SustaiNLP 2023: 91-109
[c316]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/CamposKRZM23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/CamposKRZM23
Daniel Campos, Surya Kallumadi, Corby Rosset, Cheng Xiang Zhai, Alessandro Magnani:
OVERVIEW OF THE TREC 2023 PRODUCT PRODUCT SEARCH TRACK. TREC 2023
[c315]
- view
  authority control:
- export record
  dblp key:
  - conf/www/BhavyaXZ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/BhavyaXZ23
Bhavya, Jinjun Xiong, Chengxiang Zhai:
CAM: A Large Language Model-based Creative Analogy Mining Framework. WWW 2023: 3903-3914
[i47]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2302-05717
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2302-05717
Jiayu Liu, Zhenya Huang, Chengxiang Zhai, Qi Liu:
Learning by Applying: A General Framework for Mathematical Reasoning via Enhancing Explicit Knowledge Learning. CoRR abs/2302.05717 (2023)
[i46]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2303-00333
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2303-00333
Adam Davies, Jize Jiang, ChengXiang Zhai:
Competence-Based Analysis of Language Models. CoRR abs/2303.00333 (2023)
[i45]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2303-17612
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2303-17612
Daniel Campos, Alexandre Marques, Mark Kurtz, ChengXiang Zhai:
oBERTa: Improving Sparse Transfer Learning via improved initialization, distillation, and pruning regimes. CoRR abs/2303.17612 (2023)
[i44]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2304-00114
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2304-00114
Daniel Campos, ChengXiang Zhai:
Dense Sparse Retrieval: Using Sparse Language Models for Inference Efficient Dense Retrieval. CoRR abs/2304.00114 (2023)
[i43]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2304-01016
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2304-01016
Daniel Campos, Alessandro Magnani, ChengXiang Zhai:
Quick Dense Retrievers Consume KALE: Post Training Kullback Leibler Alignment of Embeddings for Asymmetrical dual encoders. CoRR abs/2304.01016 (2023)
[i42]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2304-02721
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2304-02721
Daniel Campos, ChengXiang Zhai:
To Asymmetry and Beyond: Structured Pruning of Sequence to Sequence Models for Improved Inference Efficiency. CoRR abs/2304.02721 (2023)
[i41]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2304-03401
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2304-03401
Daniel Campos, ChengXiang Zhai, Alessandro Magnani:
Noise-Robust Dense Retrieval via Contrastive Alignment Post Training. CoRR abs/2304.03401 (2023)
[i40]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2305-16470
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2305-16470
Chenkai Sun, Jinning Li, Hou Pong Chan, ChengXiang Zhai, Heng Ji:
Measuring the Effect of Influential Messages on Varying Personas. CoRR abs/2305.16470 (2023)
[i39]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2306-08550
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2306-08550
Krisztian Balog, ChengXiang Zhai:
User Simulation for Evaluating Information Access Systems. CoRR abs/2306.08550 (2023)
[i38]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2306-11197
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2306-11197
Liliang Ren, Yang Liu, Shuohang Wang, Yichong Xu, Chenguang Zhu, ChengXiang Zhai:
Sparse Modular Activation for Efficient Sequence Modeling. CoRR abs/2306.11197 (2023)
[i37]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2306-15245
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2306-15245
Liliang Ren, Mankeerat Sidhu, Qi Zeng, Revanth Gangi Reddy, Heng Ji, ChengXiang Zhai:
C-PMI: Conditional Pointwise Mutual Information for Turn-level Dialogue Evaluation. CoRR abs/2306.15245 (2023)
[i36]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2310-13297
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2310-13297
Chenkai Sun, Jinning Li, Yi R. Fung, Hou Pong Chan, Tarek F. Abdelzaher, ChengXiang Zhai, Heng Ji:
Decoding the Silent Majority: Inducing Belief Augmented Social Graph with Large Language Model for Response Forecasting. CoRR abs/2310.13297 (2023)
[i35]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2310-14340
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2310-14340
Revanth Gangi Reddy, Hao Bai, Wentao Yao, Sharath Chandra Etagi Suresh, Heng Ji, ChengXiang Zhai:
Social Commonsense-Guided Search Query Generation for Open-Domain Knowledge-Powered Conversations. CoRR abs/2310.14340 (2023)
[i34]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2311-07861
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2311-07861
Daniel Campos, Surya Kallumadi, Corby Rosset, ChengXiang Zhai, Alessandro Magnani:
Overview of the TREC 2023 Product Product Search Track. CoRR abs/2311.07861 (2023)
2022
[j65]
- view
  authority control:
- export record
  dblp key:
  - journals/csur/KarmakerHSXZV22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/csur/KarmakerHSXZV22
Shubhra Kanti Karmaker Santu, Md. Mahadi Hassan, Micah J. Smith, Lei Xu, Chengxiang Zhai, Kalyan Veeramachaneni:
AutoML to Date and Beyond: Challenges and Opportunities. ACM Comput. Surv. 54(8): 175:1-175:36 (2022)
[j64]
- view
  authority control:
- export record
  dblp key:
  - journals/tkde/ZhaoJQLZW22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tkde/ZhaoJQLZW22
Sendong Zhao, Meng Jiang, Bing Qin, Ting Liu, ChengXiang Zhai, Fei Wang:
Structural and Textual Information Fusion for Symptom and Disease Representation Learning. IEEE Trans. Knowl. Data Eng. 34(9): 4468-4483 (2022)
[c314]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/Akash0CL0Z22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/Akash0CL0Z22
Pritom Saha Akash, Jie Huang, Kevin Chen-Chuan Chang, Yunyao Li, Lucian Popa, ChengXiang Zhai:
Domain Representative Keywords Selection: A Probabilistic Approach. ACL (Findings) 2022: 679-692
[c313]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LaiJZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LaiJZ22
Tuan Manh Lai, Heng Ji, ChengXiang Zhai:
Improving Candidate Retrieval with Entity Profile Generation for Wikidata Entity Linking. ACL (Findings) 2022: 3696-3711
[c312]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/ZhangZJMDPZH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/ZhangZJMDPZH22
Yu Zhang, Yunyi Zhang, Yucheng Jiang, Martin Michalski, Yu Deng, Lucian Popa, ChengXiang Zhai, Jiawei Han:
Entity Set Co-Expansion in StackOverflow. IEEE Big Data 2022: 4792-4795
[c311]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/coling/HuangZJ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/HuangZJ22
Kung-Hsiang Huang, ChengXiang Zhai, Heng Ji:
CONCRETE: Improving Cross-lingual Fact-checking with Cross-lingual Retrieval. COLING 2022: 1024-1035
[c310]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/LabhishettyZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/LabhishettyZ22
Sahiti Labhishetty, ChengXiang Zhai:
RATE: A Reliability-Aware Tester-Based Evaluation Framework of User Simulators. ECIR (1) 2022: 336-350
[c309]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/RenZWVZJ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/RenZWVZJ22
Liliang Ren, Zixuan Zhang, Han Wang, Clare R. Voss, ChengXiang Zhai, Heng Ji:
Language Model Pre-Training with Sparse Latent Typing. EMNLP 2022: 1480-1494
[c308]
- view
  authority control:
- export record
  dblp key:
  - conf/hci/DeyZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/hci/DeyZ22
Priyanka Dey, ChengXiang Zhai:
Fine Grained Categorization of Drug Usage Tweets. HCI (14) 2022: 267-280
[c307]
- view
  authority control:
- export record
  dblp key:
  - conf/icbk/BoughoulaRZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icbk/BoughoulaRZ22
Assma Boughoula, Kevin Ros, ChengXiang Zhai:
An Optimization Approach to Automatic Construction of Browsable Concept Index for Organizing Online Educational Content. ICKG 2022: 22-31
[c306]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/Zhai22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/Zhai22
ChengXiang Zhai:
I3A: An Intelligent Interactive Information Agent Model for Information Retrieval. ICTIR 2022: 2
[c305]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/LabhishettyZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/LabhishettyZ22
Sahiti Labhishetty, ChengXiang Zhai:
PRE: A Precision-Recall-Effort Optimization Framework for Query Simulation. ICTIR 2022: 51-60
[c304]
- view
  - electronic edition @ aaai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/icwsm/DharawatLMZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/DharawatLMZ22
Arkin Dharawat, Ismini Lourentzou, Alex Morales, ChengXiang Zhai:
Drink Bleach or Do What Now? COVID-HeRA: A Study of Risk-Informed Health Decision Making in the Presence of COVID-19 Misinformation. ICWSM 2022: 1218-1227
[c303]
- view
  authority control:
- export record
  dblp key:
  - conf/pasc/SatheesanBDCZZ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pasc/SatheesanBDCZZ22
Sandeep Puthanveetil Satheesan, Bhavya, Adam Davies, Alan B. Craig, Yu Zhang, ChengXiang Zhai:
Toward a big data analysis system for historical newspaper collections research. PASC 2022: 12:1-12:11
[c302]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/LabhishettyZXGS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/LabhishettyZXGS22
Sahiti Labhishetty, ChengXiang Zhai, Min Xie, Lin Gong, Rahul Sharnagat, Satya Chembolu:
Differential Query Semantic Analysis: Discovery of Explicit Interpretable Knowledge from E-Com Search Logs. WSDM 2022: 535-543
[i33]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2202-13404
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2202-13404
Tuan Manh Lai, Heng Ji, ChengXiang Zhai:
Improving Candidate Retrieval with Entity Profile Generation for Wikidata Entity Linking. CoRR abs/2202.13404 (2022)
[i32]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2203-10365
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2203-10365
Pritom Saha Akash, Jie Huang, Kevin Chen-Chuan Chang, Yunyao Li, Lucian Popa, ChengXiang Zhai:
Domain Representative Keywords Selection: A Probabilistic Approach. CoRR abs/2203.10365 (2022)
[i31]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2205-12452
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2205-12452
Daniel Campos, Alexandre Marques, Tuan Nguyen, Mark Kurtz, ChengXiang Zhai:
Sparse*BERT: Sparse Models are Robust. CoRR abs/2205.12452 (2022)
[i30]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2209-00068
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2209-00068
Chenkai Sun, Tie Xu, ChengXiang Zhai, Heng Ji:
Incorporating Task-specific Concept Knowledge into Script Learning. CoRR abs/2209.00068 (2022)
[i29]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2209-02071
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2209-02071
Kung-Hsiang Huang, ChengXiang Zhai, Heng Ji:
CONCRETE: Improving Cross-lingual Fact-checking with Cross-lingual Retrieval. CoRR abs/2209.02071 (2022)
[i28]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2210-04186
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2210-04186
Bhavya, Jinjun Xiong, Chengxiang Zhai:
Analogy Generation by Prompting Large Language Models: A Case Study of InstructGPT. CoRR abs/2210.04186 (2022)
[i27]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2210-12582
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2210-12582
Liliang Ren, Zixuan Zhang, Han Wang, Clare R. Voss, Chengxiang Zhai, Heng Ji:
Language Model Pre-Training with Sparse Latent Typing. CoRR abs/2210.12582 (2022)
[i26]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2211-08228
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2211-08228
Kevin Pei, Ishan Jindal, Kevin Chen-Chuan Chang, Chengxiang Zhai, Yunyao Li:
When to Use What: An In-Depth Comparative Empirical Analysis of OpenIE Systems for Downstream Applications. CoRR abs/2211.08228 (2022)
[i25]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2212-02271
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2212-02271
Yu Zhang, Yunyi Zhang, Yucheng Jiang, Martin Michalski, Yu Deng, Lucian Popa, ChengXiang Zhai, Jiawei Han:
Entity Set Co-Expansion in StackOverflow. CoRR abs/2212.02271 (2022)
2021
[c301]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LaiJZT20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LaiJZT20
Tuan Manh Lai, Heng Ji, ChengXiang Zhai, Quan Hung Tran:
Joint Biomedical Entity and Relation Extraction with Knowledge-Enhanced Collective Inference. ACL/IJCNLP (1) 2021: 6248-6260
[c300]
- view
  authority control:
- export record
  dblp key:
  - conf/bibm/LabhishettyLVMZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bibm/LabhishettyLVMZ21
Sahiti Labhishetty, Ismini Lourentzou, Michael Jeffrey Volk, Shekhar Mishra, Huimin Zhao, Chengxiang Zhai:
TriGORank: A Gene Ontology Enriched Learning-to-Rank Framework for Trigenic Fitness Prediction. BIBM 2021: 1841-1848
[c299]
- view
  authority control:
- export record
  dblp key:
  - conf/bibm/SunLXPZJ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bibm/SunLXPZJ21
Chenkai Sun, Weijiang Li, Jinfeng Xiao, Nikolaus Nova Parulian, ChengXiang Zhai, Heng Ji:
Fine-Grained Chemical Entity Typing with Multimodal Knowledge Representation. BIBM 2021: 1984-1991
[c298]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/RosEJZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/RosEJZ21
Kevin Ros, Carl Edwards, Heng Ji, Chengxiang Zhai:
Team Skeletor at Touché 2021: Argument Retrieval and Visualization for Controversial Questions. CLEF (Working Notes) 2021: 2441-2454
[c297]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/KuziZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/KuziZ21
Saar Kuzi, ChengXiang Zhai:
A Study of Distributed Representations for Figures of Research Articles. ECIR (1) 2021: 284-297
[c296]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SeylerLWZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SeylerLWZ21
Dominic Seyler, Wei Liu, XiaoFeng Wang, ChengXiang Zhai:
Towards Dark Jargon Interpretation in Underground Forums. ECIR (2) 2021: 393-400
[c295]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/EdwardsZJ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/EdwardsZJ21
Carl Edwards, ChengXiang Zhai, Heng Ji:
Text2Mol: Cross-Modal Molecule Retrieval with Natural Language Queries. EMNLP (1) 2021: 595-607
[c294]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LaiJZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LaiJZ21
Tuan Manh Lai, Heng Ji, ChengXiang Zhai:
BERT might be Overkill: A Tiny but Effective Biomedical Entity Linker based on Residual Convolutional Neural Networks. EMNLP (Findings) 2021: 1631-1639
[c293]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/LiuDJZT21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/LiuDJZT21
Lihui Liu, Boxin Du, Heng Ji, ChengXiang Zhai, Hanghang Tong:
Neural-Answering Logical Queries on Knowledge Graphs. KDD 2021: 1087-1097
[c292]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/BhavyaXZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/BhavyaXZ21
Bhavya, Jinfeng Xiao, Chengxiang Zhai:
Scaling Up Data Science Course Projects: A Case Study. L@S 2021: 311-314
[c291]
- view
  authority control:
- export record
  dblp key:
  - conf/petra/LourentzouGAGRD21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/petra/LourentzouGAGRD21
Ismini Lourentzou, Daniel Gruhl, Alfredo Alba, Anna Lisa Gentile, Petar Ristoski, Chad DeLuca, Steven R. Welch, Chengxiang Zhai:
AdaReNet: Adaptive Reweighted Semi-supervised Active Learning to Accelerate Label Acquisition. PETRA 2021: 431-438
[c290]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/MessaoudLBZZZS21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/MessaoudLBZZZS21
Safa Messaoud, Ismini Lourentzou, Assma Boughoula, Mona Zehni, Zhizhen Zhao, Chengxiang Zhai, Alexander G. Schwing:
DeepQAMVS: Query-Aware Hierarchical Pointer Networks for Multi-Video Summarization. SIGIR 2021: 1389-1399
[c289]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LabhishettyZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LabhishettyZ21
Sahiti Labhishetty, Chengxiang Zhai:
An Exploration of Tester-based Evaluation of User Simulators for Comparing Interactive Retrieval Systems. SIGIR 2021: 1598-1602
[c288]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SeylerLZ0Z21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SeylerLZ0Z21
Dominic Seyler, Wei Liu, Yunan Zhang, XiaoFeng Wang, ChengXiang Zhai:
DarkJargon.net: A Platform for Understanding Underground Conversation with Latent Meaning. SIGIR 2021: 2526-2530
[c287]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Zhai21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Zhai21
Chengxiang Zhai:
Interactive Information Retrieval: Models, Algorithms, and Evaluation. SIGIR 2021: 2662-2665
[i24]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2105-06441
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2105-06441
Safa Messaoud, Ismini Lourentzou, Assma Boughoula, Mona Zehni, Zhizhen Zhao, Chengxiang Zhai, Alexander G. Schwing:
DeepQAMVS: Query-Aware Hierarchical Pointer Networks for Multi-Video Summarization. CoRR abs/2105.06441 (2021)
[i23]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2105-13456
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2105-13456
Tuan Manh Lai, Heng Ji, ChengXiang Zhai, Quan Hung Tran:
Joint Biomedical Entity and Relation Extraction with Knowledge-Enhanced Collective Inference. CoRR abs/2105.13456 (2021)
[i22]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2108-12899
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2108-12899
Chenkai Sun, Weijiang Li, Jinfeng Xiao, Nikolaus Nova Parulian, ChengXiang Zhai, Heng Ji:
Fine-Grained Chemical Entity Typing with Multimodal Knowledge Representation. CoRR abs/2108.12899 (2021)
[i21]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2109-02237
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2109-02237
Tuan Manh Lai, Heng Ji, ChengXiang Zhai:
BERT might be Overkill: A Tiny but Effective Biomedical Entity Linker based on Residual Convolutional Neural Networks. CoRR abs/2109.02237 (2021)
2020
[j63]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/AmigoFMZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/AmigoFMZ20
Enrique Amigó, Hui Fang, Stefano Mizzaro, Chengxiang Zhai:
Axiomatic thinking for information retrieval: introduction to special issue. Inf. Retr. J. 23(3): 187-190 (2020)
[c286]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/WangWXQZL20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/WangWXQZL20
Yiren Wang, Lijun Wu, Yingce Xia, Tao Qin, ChengXiang Zhai, Tie-Yan Liu:
Transductive Ensemble Learning for Neural Machine Translation. AAAI 2020: 6291-6298
[c285]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/GandhiMCAZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/GandhiMCAZ20
Nupoor Gandhi, Alex Morales, Sally Man-Pui Chan, Dolores Albarracin, ChengXiang Zhai:
Predicting Opioid Overdose Crude Rates with Text-Based Twitter Features (Student Abstract). AAAI 2020: 13787-13788
[c284]
- view
  authority control:
- export record
  dblp key:
  - conf/asunam/SeylerLZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asunam/SeylerLZ20
Dominic Seyler, Lunan Li, ChengXiang Zhai:
Semantic Text Analysis for Detection of Compromised Accounts on Social Networks. ASONAM 2020: 417-424
[c283]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KarmakerSZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KarmakerSZ20
Shubhra (Santu) K. Karmaker, Parikshit Sondhi, ChengXiang Zhai:
Empirical Analysis of Impact of Query-Specific Customization of nDCG: A Case-Study with Learning-to-Rank Methods. CIKM 2020: 3281-3284
[c282]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/WangZH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/WangZH20
Yiren Wang, ChengXiang Zhai, Hany Hassan:
Multi-task Learning for Multilingual Neural Machine Translation. EMNLP (1) 2020: 1022-1034
[c281]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/SeylerSXWZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/SeylerSXWZ20
Dominic Seyler, Jiaming Shen, Jinfeng Xiao, Yiren Wang, ChengXiang Zhai:
Leveraging Personalized Sentiment Lexicons for Sentiment Analysis. ICTIR 2020: 109-112
[c280]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/kdd/SeylerBBZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/SeylerBBZ20
Dominic Seyler, Paul Bruin, Pavan Bayyapu, ChengXiang Zhai:
Finding Contextually Consistent Information Units in Legal Text. NLLP@KDD 2020: 48-51
[c279]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/BhavyaZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/BhavyaZ20
Bhavya, ChengXiang Zhai:
Explanation Mining. L@S 2020: 321-324
[c278]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/BoughoulaSZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/BoughoulaSZ20
Assma Boughoula, Aidan San, ChengXiang Zhai:
Leveraging Book Indexes for Automatic Extraction of Concepts in MOOCs. L@S 2020: 381-384
[c277]
- view
  authority control:
- export record
  dblp key:
  - conf/pakdd/MoralesNSZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pakdd/MoralesNSZ20
Alex Morales, Kanika Narang, Hari Sundaram, Chengxiang Zhai:
CrowdQM: Learning Aspect-Level User Reliability and Comment Trustworthiness in Discussion Forums. PAKDD (1) 2020: 592-605
[c276]
- view
  authority control:
- export record
  dblp key:
  - conf/sigcse/BhavyaBGZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigcse/BhavyaBGZ20
Bhavya, Assma Boughoula, Aaron Green, ChengXiang Zhai:
Collective Development of Large Scale Data Science Products via Modularized Assignments: An Experience Report. SIGCSE 2020: 1200-1206
[c275]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SeylerZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SeylerZ20
Dominic Seyler, ChengXiang Zhai:
A Study of Methods for the Generation of Domain-Aware Word Embeddings. SIGIR 2020: 1609-1612
[c274]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KuziZTT20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KuziZTT20
Saar Kuzi, ChengXiang Zhai, Yin Tian, Haichuan Tang:
FigExplorer: A System for Retrieval and Exploration of Figures from Collections of Research Articles. SIGIR 2020: 2133-2136
[c273]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Zhai20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Zhai20
ChengXiang Zhai:
Interactive Information Retrieval: Models, Algorithms, and Evaluation. SIGIR 2020: 2444-2447
[e9]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/2020
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/2020
Xintao Wu, Chris Jermaine, Li Xiong, Xiaohua Hu, Olivera Kotevska, Siyuan Lu, Weija Xu, Srinivas Aluru, Chengxiang Zhai, Eyhab Al-Masri, Zhiyuan Chen, Jeff Saltz:
2020 IEEE International Conference on Big Data (IEEE BigData 2020), Atlanta, GA, USA, December 10-13, 2020. IEEE 2020, ISBN 978-1-7281-6251-5 [contents]
[i20]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2002-08577
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2002-08577
Yinan Zhang, Parikshit Sondhi, Anjan Goswami, ChengXiang Zhai:
Towards a Soft Faceted Browsing Scheme for Information Access. CoRR abs/2002.08577 (2020)
[i19]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2010-02523
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-02523
Yiren Wang, ChengXiang Zhai, Hany Hassan Awadalla:
Multi-task Learning for Multilingual Neural Machine Translation. CoRR abs/2010.02523 (2020)
[i18]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2010-08743
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-08743
Arkin Dharawat, Ismini Lourentzou, Alex Morales, ChengXiang Zhai:
Drink bleach or do what now? Covid-HeRA: A dataset for risk-informed health decision making in the presence of COVID19 misinformation. CoRR abs/2010.08743 (2020)
[i17]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2010-10777
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-10777
Shubhra Kanti Karmaker Santu, Md. Mahadi Hassan, Micah J. Smith, Lei Xu, ChengXiang Zhai, Kalyan Veeramachaneni:
A Level-wise Taxonomic Perspective on Automated Machine Learning to Date and Beyond: Challenges and Opportunities. CoRR abs/2010.10777 (2020)
[i16]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2011-03011
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2011-03011
Dominic Seyler, Wei Liu, XiaoFeng Wang, ChengXiang Zhai:
Towards Dark Jargon Interpretation in Underground Forums. CoRR abs/2011.03011 (2020)

2010 – 2019

see FAQ

What is the meaning of the colors in the publication lists?

2019
[c272]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/WangTHQZL19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/WangTHQZL19
Yiren Wang, Fei Tian, Di He, Tao Qin, ChengXiang Zhai, Tie-Yan Liu:
Non-Autoregressive Machine Translation with Auxiliary Regularization. AAAI 2019: 5377-5384
[c271]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/XiaoZYZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/XiaoZYZ19
Yuxin Xiao, Zecheng Zhang, Carl Yang, Chengxiang Zhai:
Non-local Attention Learning on Large Heterogeneous Information Networks. IEEE BigData 2019: 978-987
[c270]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/HuangLZYCGH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/HuangLZYCGH19
Zhenya Huang, Qi Liu, Chengxiang Zhai, Yu Yin, Enhong Chen, Weibo Gao, Guoping Hu:
Exploring Multi-Objective Exercise Recommendations in Online Education Systems. CIKM 2019: 1261-1270
[c269]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KuziLSJZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KuziLSJZ19
Saar Kuzi, Sahiti Labhishetty, Shubhra Kanti Karmaker Santu, Prasad Pradip Joshi, ChengXiang Zhai:
Analysis of Adaptive Training for Learning to Rank in Information Retrieval. CIKM 2019: 2325-2328
[c268]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/conll/SantuVZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/conll/SantuVZ19
Shubhra Kanti Karmaker Santu, Kalyan Veeramachaneni, Chengxiang Zhai:
TILM: Neural Language Models with Evolving Topical Influence. CoNLL 2019: 778-788
[c267]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/KuziZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/KuziZ19
Saar Kuzi, ChengXiang Zhai:
Figure Retrieval from Collections of Research Articles. ECIR (1) 2019: 696-710
[c266]
- view
  - electronic edition @ openreview.net (open access)
  - details & citations
- export record
  dblp key:
  - conf/iclr/WangXHTQZL19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/WangXHTQZL19
Yiren Wang, Yingce Xia, Tianyu He, Fei Tian, Tao Qin, ChengXiang Zhai, Tie-Yan Liu:
Multi-Agent Dual Learning. ICLR (Poster) 2019
[c265]
- view
  - electronic edition @ aaai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/icwsm/GeigleDSZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/GeigleDSZ19
Chase Geigle, Himel Dev, Hari Sundaram, ChengXiang Zhai:
A Generative Model for Discovering Action-Based Roles and Community Role Compositions on Community Question Answering Platforms. ICWSM 2019: 181-192
[c264]
- view
  - electronic edition @ aaai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/icwsm/LourentzouMZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/LourentzouMZ19
Ismini Lourentzou, Kabir Manghnani, ChengXiang Zhai:
Adapting Sequence to Sequence Models for Text Normalization in Social Media. ICWSM 2019: 335-345
[c263]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/KuziCFGZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/KuziCFGZ19
Saar Kuzi, William W. Cope, Duncan C. Ferguson, Chase Geigle, ChengXiang Zhai:
Automatic Assessment of Complex Assignments using Topic Models. L@S 2019: 13:1-13:10
[c262]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/GreenZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/GreenZ19
Aaron Green, ChengXiang Zhai:
LiveDataLab: A Cloud-Based Platform to Facilitate Hands-on Data Science Education at Scale. L@S 2019: 51:1-51:2
[c261]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/LabhishettyBPBZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/LabhishettyBPBZ19
Sahiti Labhishetty, Bhavya, Kevin Pei, Assma Boughoula, Chengxiang Zhai:
Web of Slides: Automatic Linking of Lecture Slides to Facilitate Navigation. L@S 2019: 54:1-54:4
[c260]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/LabhishettyBPBZ19a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/LabhishettyBPBZ19a
Sahiti Labhishetty, Bhavya, Kevin Pei, Assma Boughoula, Chengxiang Zhai:
WOSView Demo: A Tool to Explore the Web of Slides. L@S 2019: 55:1-55:3
[c259]
- view
- export record
  dblp key:
  - conf/nips/WangXTGQZL19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nips/WangXTGQZL19
Yiren Wang, Yingce Xia, Fei Tian, Fei Gao, Tao Qin, ChengXiang Zhai, Tie-Yan Liu:
Neural Machine Translation with Soft Prototype. NeurIPS 2019: 6313-6322
[c258]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/sigir/GoswamiZM19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/GoswamiZM19
Anjan Goswami, Chengxiang Zhai, Prasant Mohapatra:
Learning to Diversify for E-commerce Search with Multi-Armed Bandit. eCOM@SIGIR 2019
[c257]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KuziNPZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KuziNPZ19
Saar Kuzi, Abhishek Narwekar, Anusri Pampari, ChengXiang Zhai:
Help Me Search: Leveraging User-System Collaboration for Query Construction to Improve Accuracy for Difficult Queries. SIGIR 2019: 1221-1224
[c256]
- view
  authority control:
- export record
  dblp key:
  - conf/www/GoswamiMZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/GoswamiMZ19
Anjan Goswami, Prasant Mohapatra, Chengxiang Zhai:
Quantifying and Visualizing the Demand and Supply Gap from E-commerce Search Data using Topic Models. WWW (Companion Volume) 2019: 348-353
[i15]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1902-10245
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1902-10245
Yiren Wang, Fei Tian, Di He, Tao Qin, ChengXiang Zhai, Tie-Yan Liu:
Non-Autoregressive Machine Translation with Auxiliary Regularization. CoRR abs/1902.10245 (2019)
[i14]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1903-00562
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1903-00562
Shubhra Kanti Karmaker Santu, Liangda Li, Yi Chang, ChengXiang Zhai:
JIM: Joint Influence Modeling for Collective Search Behavior. CoRR abs/1903.00562 (2019)
[i13]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1903-04263
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1903-04263
Shubhra Kanti Karmaker Santu, Parikshit Sondhi, ChengXiang Zhai:
On Application of Learning to Rank for E-Commerce Search. CoRR abs/1903.04263 (2019)
[i12]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1904-06100
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1904-06100
Ismini Lourentzou, Kabir Manghnani, ChengXiang Zhai:
Adapting Sequence to Sequence models for Text Normalization in Social Media. CoRR abs/1904.06100 (2019)
[i11]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1911-04065
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1911-04065
Yunan Zhang, Xiang Cheng, Yufeng Zhang, Zihan Wang, Zhengqi Fang, Xiaoyan Wang, Zhenya Huang, Chengxiang Zhai:
Learning to Order Sub-questions for Complex Question Answering. CoRR abs/1911.04065 (2019)
[i10]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1911-10235
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1911-10235
Yiren Wang, Hongzhao Huang, Zhe Liu, Yutong Pang, Yongqiang Wang, ChengXiang Zhai, Fuchun Peng:
Improving N-gram Language Models with Pre-trained Deep Transformer. CoRR abs/1911.10235 (2019)
[i9]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1912-02206
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1912-02206
Yunan Zhang, Xiang Cheng, Heting Gao, Chengxiang Zhai:
Cooperative Reasoning on Knowledge Graph and Corpus: A Multi-agentReinforcement Learning Approach. CoRR abs/1912.02206 (2019)
2018
[j62]
- view
  authority control:
- export record
  dblp key:
  - journals/sigkdd/SantuGFCKSZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigkdd/SantuGFCKSZ18
Shubhra Kanti Karmaker Santu, Chase Geigle, Duncan C. Ferguson, William W. Cope, Mary Kalantzis, Duane Searsmith, Chengxiang Zhai:
SOFSAT: Towards a Setlike Operator based Framework for Semantic Analysis of Text. SIGKDD Explor. 20(2): 21-30 (2018)
[c255]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/MoralesGCLSBUAZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/MoralesGCLSBUAZ18
Alex Morales, Nupoor Gandhi, Man-pui Sally Chan, Sophie Lohmann, Travis Sanchez, Kathleen A. Brady, Lyle H. Ungar, Dolores Albarracin, ChengXiang Zhai:
Multi-Attribute Topic Feature Construction for Social Media-based Prediction. IEEE BigData 2018: 1073-1078
[c254]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/JiangZM18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/JiangZM18
Shan Jiang, Chengxiang Zhai, Qiaozhu Mei:
Exploiting Knowledge Graph to Improve Text-based Prediction. IEEE BigData 2018: 1407-1416
[c253]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/SantuLCZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/SantuLCZ18
Shubhra Kanti Karmaker Santu, Liangda Li, Yi Chang, ChengXiang Zhai:
JIM: Joint Influence Modeling for Collective Search Behavior. CIKM 2018: 637-646
[c252]
- view
  - electronic edition @ educationaldatamining.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/edm/AlsaadBGSZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/edm/AlsaadBGSZ18
Fareedah Alsaad, Assma Boughoula, Chase Geigle, Hari Sundaram, Chengxiang Zhai:
Mining MOOC Lecture Transcripts to Construct Concept Dependency Graphs. EDM 2018
[c251]
- view
  authority control:
- export record
  dblp key:
  - conf/iticse/GeigleLSZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iticse/GeigleLSZ18
Chase Geigle, Ismini Lourentzou, Hari Sundaram, ChengXiang Zhai:
CLaDS: a cloud-based virtual lab for the delivery of scalable hands-on assignments for practical data science education. ITiCSE 2018: 176-181
[c250]
- view
  authority control:
- export record
  dblp key:
  - conf/mldm/GoswamiZM18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mldm/GoswamiZM18
Anjan Goswami, Chengxiang Zhai, Prasant Mohapatra:
Learning to Rank and Discover for E-Commerce Search. MLDM (2) 2018: 331-346
[c249]
- view
  - electronic edition @ stanford.edu (open access)
  - details & citations
- export record
  dblp key:
  - conf/psb/HuangWZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/psb/HuangWZ18
Edward W. Huang, Sheng Wang, ChengXiang Zhai:
VisAGE: Integrating external knowledge into electronic medical record visualization. PSB 2018: 578-589
[c248]
- view
  authority control:
- export record
  dblp key:
  - conf/re/LiuLYZX18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/re/LiuLYZX18
Xueqing Liu, Yue Leng, Wei Yang, Chengxiang Zhai, Tao Xie:
Mining Android App Descriptions for Permission Requirements Recommendation. RE 2018: 147-158
[c247]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FanGLXZC18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FanGLXZC18
Yixing Fan, Jiafeng Guo, Yanyan Lan, Jun Xu, Chengxiang Zhai, Xueqi Cheng:
Modeling Diverse Relevance Patterns in Ad-hoc Retrieval. SIGIR 2018: 375-384
[c246]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Amigo0MZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Amigo0MZ18
Enrique Amigó, Hui Fang, Stefano Mizzaro, ChengXiang Zhai:
Are we on the Right Track?: An Examination of Information Retrieval Methodologies. SIGIR 2018: 997-1000
[c245]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/sigir/GoswamiZM18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/GoswamiZM18
Anjan Goswami, Chengxiang Zhai, Prasant Mohapatra:
Towards Optimization of e-Commerce Search and Discovery. eCOM@SIGIR 2018
[c244]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SondhiSKZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SondhiSKZ18
Parikshit Sondhi, Mohit Sharma, Pranam Kolari, ChengXiang Zhai:
A Taxonomy of Queries for E-commerce Search. SIGIR 2018: 1245-1248
[c243]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhaiG18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhaiG18
ChengXiang Zhai, Chase Geigle:
A Tutorial on Probabilistic Topic Models for Text Data Retrieval and Analysis. SIGIR 2018: 1395-1398
[c242]
- view
  authority control:
- export record
  dblp key:
  - conf/sigsoft/Liu0LZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigsoft/Liu0LZ18
Xueqing Liu, Chi Wang, Yue Leng, ChengXiang Zhai:
LinkSO: a dataset for learning to retrieve similar question answer pairs on software development forums. NL4SE@ESEC/SIGSOFT FSE 2018: 2-5
[c241]
- view
  authority control:
- export record
  dblp key:
  - conf/vl/LiuLYWZX18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/vl/LiuLYWZX18
Xueqing Liu, Yue Leng, Wei Yang, Wenyu Wang, Chengxiang Zhai, Tao Xie:
A Large-Scale Empirical Study on Android Runtime-Permission Rationale Messages. VL/HCC 2018: 137-146
[c240]
- view
  authority control:
- export record
  dblp key:
  - conf/wpes/SantuBZG18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wpes/SantuBZG18
Shubhra Kanti Karmaker Santu, Vincent Bindschaedler, ChengXiang Zhai, Carl A. Gunter:
NRF: A Naive Re-identification Framework. WPES@CCS 2018: 121-132
[e8]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/2018
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/2018
Yi Chang, Chengxiang Zhai, Yan Liu, Yoelle Maarek:
Proceedings of the Eleventh ACM International Conference on Web Search and Data Mining, WSDM 2018, Marina Del Rey, CA, USA, February 5-9, 2018. ACM 2018, ISBN 978-1-4503-5581-0 [contents]
[r4]
- view
  authority control:
- export record
  dblp key:
  - reference/db/0001Z18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/db/0001Z18
Hui Fang, ChengXiang Zhai:
Web Search Relevance Feedback. Encyclopedia of Database Systems (2nd ed.) 2018
[r3]
- view
  authority control:
- export record
  dblp key:
  - reference/db/ShenZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/db/ShenZ18
Xuehua Shen, ChengXiang Zhai:
Web Search Result De-duplication and Clustering. Encyclopedia of Database Systems (2nd ed.) 2018
[i8]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1804-07247
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1804-07247
Dominic Seyler, Lunan Li, ChengXiang Zhai:
Identifying Compromised Accounts on Social Media Using Statistical Text Analysis. CoRR abs/1804.07247 (2018)
[i7]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1805-05737
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1805-05737
Yixing Fan, Jiafeng Guo, Yanyan Lan, Jun Xu, Chengxiang Zhai, Xueqi Cheng:
Modeling Diverse Relevance Patterns in Ad-hoc Retrieval. CoRR abs/1805.05737 (2018)
2017
[j61]
- view
  authority control:
- export record
  dblp key:
  - journals/scientometrics/BaoZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/scientometrics/BaoZ17
Peng Bao, Chengxiang Zhai:
Dynamic credit allocation in scientific literature. Scientometrics 112(1): 595-606 (2017)
[j60]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/LaffertyZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/LaffertyZ17
John D. Lafferty, Chengxiang Zhai:
Document Language Models, Query Models, and Risk Minimization for Information Retrieval. SIGIR Forum 51(2): 251-259 (2017)
[j59]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/ZhaiL17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/ZhaiL17
Chengxiang Zhai, John D. Lafferty:
A Study of Smoothing Methods for Language Models Applied to Ad Hoc Information Retrieval. SIGIR Forum 51(2): 268-276 (2017)
[j58]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/Amigo0MZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/Amigo0MZ17
Enrique Amigó, Hui Fang, Stefano Mizzaro, ChengXiang Zhai:
Report on the SIGIR 2017 Workshop on Axiomatic Thinking for Information Retrieval and Related Tasks (ATIR). SIGIR Forum 51(3): 99-106 (2017)
[c239]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/WangWZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/WangWZ17
Xiaolong Wang, Jingjing Wang, Chengxiang Zhai:
Dual-Clustering Maximum Entropy with Application to Classification and Word Embedding. AAAI 2017: 3323-3329
[c238]
- view
  authority control:
- export record
  dblp key:
  - conf/airs/YangZCZ017
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/airs/YangZCZ017
Peilin Yang, Mianwei Zhou, Yi Chang, Chengxiang Zhai, Hui Fang:
Towards Privacy-Preserving Evaluation for Information Retrieval Models Over Industry Data Sets. AIRS 2017: 210-221
[c237]
- view
- export record
  dblp key:
  - conf/amia/HuangWLZLZZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amia/HuangWLZLZZ17
Edward W. Huang, Sheng Wang, Doris J. Lee, Runshun Zhang, Baoyan Liu, Xuezhong Zhou, ChengXiang Zhai:
Framing Electronic Medical Records as Polylingual Documents in Query Expansion. AMIA 2017
[c236]
- view
  authority control:
- export record
  dblp key:
  - conf/bcb/HuangWLZLZLZLZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bcb/HuangWLZLZLZLZ17
Edward W. Huang, Sheng Wang, Bingxue Li, Ran Zhang, Baoyan Liu, Runshun Zhang, Jie Liu, Xuezhong Zhou, Hongsheng Lin, ChengXiang Zhai:
HEMnet: Integration of Electronic Medical Records with Molecular Interaction Networks and Domain Knowledge for Survival Analysis. BCB 2017: 378-387
[c235]
- view
  authority control:
- export record
  dblp key:
  - conf/bibm/QianPPZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bibm/QianPPZ17
Mingjie Qian, Jyotishman Pathak, Naveen L. Pereira, Chengxiang Zhai:
Temporal reflected logistic regression for probabilistic heart failure survival score prediction. BIBM 2017: 410-416
[c234]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/Zhai17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/Zhai17
ChengXiang Zhai:
TextScope: Enhance human perception via text mining. IEEE BigData 2017: 6
[c233]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/LourentzouMZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/LourentzouMZ17
Ismini Lourentzou, Alex Morales, ChengXiang Zhai:
Text-based geolocation prediction of social media users with neural networks. IEEE BigData 2017: 696-705
[c232]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WangSSZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WangSSZ17
Yiren Wang, Dominic Seyler, Shubhra Kanti Karmaker Santu, ChengXiang Zhai:
A Study of Feature Construction for Text-based Forecasting of Time Series Variables. CIKM 2017: 2347-2350
[c231]
- view
  - electronic edition @ educationaldatamining.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/edm/GeigleZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/edm/GeigleZ17
Chase Geigle, Chengxiang Zhai:
Modeling MOOC Student Behavior With Two-Layer Hidden Markov Models. EDM 2017
[c230]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/MoralesZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/MoralesZ17
Alex Morales, Chengxiang Zhai:
Identifying Humor in Reviews using Background Text Sources. EMNLP 2017: 492-501
[c229]
- view
  - electronic edition @ mlr.press (open access)
  - details & citations
- export record
  dblp key:
  - conf/icml/ZhuWZG17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icml/ZhuWZG17
Rongda Zhu, Lingxiao Wang, Chengxiang Zhai, Quanquan Gu:
High-Dimensional Variance-Reduced Stochastic Gradient Expectation-Maximization Algorithm. ICML 2017: 4180-4188
[c228]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/ZhangLZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/ZhangLZ17
Yinan Zhang, Xueqing Liu, ChengXiang Zhai:
Information Retrieval Evaluation as Search Simulation: A General Formal Framework for IR Evaluation. ICTIR 2017: 193-200
[c227]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/ijcai/ZhaoJYQLZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/ZhaoJYQLZ17
Stan Zhao, Meng Jiang, Quan Yuan, Bing Qin, Ting Liu, ChengXiang Zhai:
ContextCare: Incorporating Contextual Information Networks to Representation Learning on Medical Forum Data. IJCAI 2017: 3497-3503
[c226]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/GeigleZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/GeigleZ17
Chase Geigle, ChengXiang Zhai:
Modeling MOOC Student Behavior With Two-Layer Hidden Markov Models. L@S 2017: 205-208
[c225]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/BoughoulaGZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/BoughoulaGZ17
Assma Boughoula, Chase Geigle, ChengXiang Zhai:
A Probabilistic Approach for Discovering Difficult Course Topics Using Clickstream Data. L@S 2017: 303-306
[c224]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SantuSZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SantuSZ17
Shubhra Kanti Karmaker Santu, Parikshit Sondhi, ChengXiang Zhai:
On Application of Learning to Rank for E-Commerce Search. SIGIR 2017: 475-484
[c223]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Zhai17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Zhai17
ChengXiang Zhai:
Probabilistic Topic Models for Text Data Retrieval and Analysis. SIGIR 2017: 1399-1401
[c222]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Amigo0MZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Amigo0MZ17
Enrique Amigó, Hui Fang, Stefano Mizzaro, ChengXiang Zhai:
Axiomatic Thinking for Information Retrieval: And Related Tasks. SIGIR 2017: 1419-1420
[c221]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/ZhaoWMQLWZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/ZhaoWMQLWZ17
Sendong Zhao, Quan Wang, Sean Massung, Bing Qin, Ting Liu, Bin Wang, ChengXiang Zhai:
Constructing and Embedding Abstract Event Causality Networks from Text Snippets. WSDM 2017: 335-344
[c220]
- view
  authority control:
- export record
  dblp key:
  - conf/www/SantuLPCZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/SantuLPCZ17
Shubhra Kanti Karmaker Santu, Liangda Li, Dae Hoon Park, Yi Chang, ChengXiang Zhai:
Modeling the Influence of Popular Trending Events on User Search Behavior. WWW (Companion Volume) 2017: 535-544
[c219]
- view
  authority control:
- export record
  dblp key:
  - conf/www/LiuZHG17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/LiuZHG17
Xueqing Liu, ChengXiang Zhai, Wei Han, Onur Güngör:
Numerical Facet Range Partition: Evaluation Metric and Methods. WWW (Companion Volume) 2017: 662-671
2016
[j57]
- view
  authority control:
- export record
  dblp key:
  - journals/bioinformatics/PengYWZMZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bioinformatics/PengYWZMZ16
Shengwen Peng, Ronghui You, Hongning Wang, Chengxiang Zhai, Hiroshi Mamitsuka, Shanfeng Zhu:
DeepMeSH: deep semantic representation for improving large-scale MeSH indexing. Bioinform. 32(12): 70-79 (2016)
[j56]
- view
  - electronic edition @ computer.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/debu/Zhai16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/debu/Zhai16
ChengXiang Zhai:
Towards a game-theoretic framework for text data retrieval. IEEE Data Eng. Bull. 39(3): 51-62 (2016)
[j55]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/LeginusZD16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/LeginusZD16
Martin Leginus, ChengXiang Zhai, Peter Dolog:
Personalized generation of word clouds from tweets. J. Assoc. Inf. Sci. Technol. 67(5): 1021-1032 (2016)
[j54]
- view
  authority control:
- export record
  dblp key:
  - journals/nle/MassungZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nle/MassungZ16
Sean Massung, Chengxiang Zhai:
Non-native text analysis: A survey. Nat. Lang. Eng. 22(2): 163-186 (2016)
[c218]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/acl/MassungGZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/MassungGZ16
Sean Massung, Chase Geigle, ChengXiang Zhai:
MeTA: A Unified Toolkit for Text Retrieval and Analysis. ACL (System Demonstrations) 2016: 91-96
[c217]
- view
  authority control:
- export record
  dblp key:
  - conf/bcb/HuangWZLZZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bcb/HuangWZLZZ16
Edward W. Huang, Sheng Wang, Runshun Zhang, Baoyan Liu, Xuezhong Zhou, ChengXiang Zhai:
PaReCat: Patient Record Subcategorization for Precision Traditional Chinese Medicine. BCB 2016: 443-452
[c216]
- view
  authority control:
- export record
  dblp key:
  - conf/bibm/WangHZZLZZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bibm/WangHZZLZZ16
Sheng Wang, Edward W. Huang, Runshun Zhang, Xiaoping Zhang, Baoyan Liu, Xuezhong Zhou, ChengXiang Zhai:
A conditional probabilistic model for joint analysis of symptoms, diseases, and herbs in traditional Chinese medicine patient records. BIBM 2016: 411-418
[c215]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/ZhuZPZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/ZhuZPZ16
Rongda Zhu, Aston Zhang, Jian Peng, Chengxiang Zhai:
Exploiting temporal divergence of topic distributions for event detection. IEEE BigData 2016: 164-171
[c214]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/SantuSZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/SantuSZ16
Shubhra Kanti Karmaker Santu, Parikshit Sondhi, ChengXiang Zhai:
Generative Feature Language Models for Mining Implicit Features from Customer Reviews. CIKM 2016: 929-938
[c213]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ParkFLZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ParkFLZ16
Dae Hoon Park, Yi Fang, Mengwen Liu, ChengXiang Zhai:
Mobile App Retrieval for Social Media Users via Inference of Implicit Intent in Social Media Text. CIKM 2016: 959-968
[c212]
- view
  authority control:
- export record
  dblp key:
  - conf/icdm/WangWJZC16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icdm/WangWJZC16
Xiaolong Wang, Jingjing Wang, Luo Jie, Chengxiang Zhai, Yi Chang:
Blind Men and The Elephant: Thurstonian Pairwise Preference for Ranking in Crowdsourcing. ICDM 2016: 509-518
[c211]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/GeigleZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/GeigleZ16
Chase Geigle, ChengXiang Zhai:
Scaling up Online Question Answering via Similar Question Retrieval. L@S 2016: 257-260
[c210]
- view
  authority control:
- export record
  dblp key:
  - conf/lats/GeigleZF16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lats/GeigleZF16
Chase Geigle, ChengXiang Zhai, Duncan C. Ferguson:
An Exploration of Automated Grading of Complex Assignments. L@S 2016: 351-360
[c209]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhangZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhangZ16
Yinan Zhang, ChengXiang Zhai:
A Sequential Decision Formulation of the Interface Card Model for Interactive IR. SIGIR 2016: 85-94
[c208]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JiangHKDYCZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JiangHKDYCZ16
Shan Jiang, Yuening Hu, Changsung Kang, Tim Daly Jr., Dawei Yin, Yi Chang, ChengXiang Zhai:
Learning Query and Document Relevance from a Web-scale Click Graph. SIGIR 2016: 185-194
[e7]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/2016
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/2016
Snehasis Mukhopadhyay, ChengXiang Zhai, Elisa Bertino, Fabio Crestani, Javed Mostafa, Jie Tang, Luo Si, Xiaofang Zhou, Yi Chang, Yunyao Li, Parikshit Sondhi:
Proceedings of the 25th ACM International Conference on Information and Knowledge Management, CIKM 2016, Indianapolis, IN, USA, October 24-28, 2016. ACM 2016, ISBN 978-1-4503-4073-1 [contents]
[i6]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/LiuZHG16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LiuZHG16
Xueqing Liu, ChengXiang Zhai, Wei Han, Onur Güngör:
Numerical Range Facets Partition: Evaluation Metric and Methods. CoRR abs/1610.10000 (2016)
2015
[j53]
- view
  authority control:
- export record
  dblp key:
  - journals/bioinformatics/0002PWZMZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bioinformatics/0002PWZMZ15
Ke Liu, Shengwen Peng, Junqiu Wu, ChengXiang Zhai, Hiroshi Mamitsuka, Shanfeng Zhu:
MeSHLabeler: improving the accuracy of large-scale MeSH indexing by integrating diverse evidence. Bioinform. 31(12): 339-347 (2015)
[j52]
- view
  authority control:
- export record
  dblp key:
  - journals/bioinformatics/WangCZB015
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bioinformatics/WangCZB015
Sheng Wang, Hyunghoon Cho, ChengXiang Zhai, Bonnie Berger, Jian Peng:
Exploiting ontology graph for predicting sparsely annotated gene function. Bioinform. 31(12): 357-364 (2015)
[j51]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/LvZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/LvZ15
Yuanhua Lv, ChengXiang Zhai:
Negative query generation: bridging the gap between query likelihood retrieval models and relevance. Inf. Retr. J. 18(4): 359-378 (2015)
[j50]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/GanesanZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/GanesanZ15
Kavita Ganesan, ChengXiang Zhai:
OpinoFetch: a practical and efficient approach to collecting opinions on arbitrary entities. Inf. Retr. J. 18(6): 530-558 (2015)
[j49]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/VydiswaranZRP15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/VydiswaranZRP15
V. G. Vinod Vydiswaran, ChengXiang Zhai, Dan Roth, Peter Pirolli:
Overcoming bias to learn about controversial topics. J. Assoc. Inf. Sci. Technol. 66(8): 1655-1672 (2015)
[j48]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/ZhaiCL15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/ZhaiCL15
ChengXiang Zhai, William W. Cohen, John D. Lafferty:
Beyond Independent Relevance: Methods and Evaluation Metrics for Subtopic Retrieval. SIGIR Forum 49(1): 2-9 (2015)
[j47]
- view
  authority control:
- export record
  dblp key:
  - journals/titb/ZhangCZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/titb/ZhangCZ15
Thomas Zhang, Jason H. D. Cho, Chengxiang Zhai:
Understanding User Intents in Online Health Forums. IEEE J. Biomed. Health Informatics 19(4): 1392-1398 (2015)
[c207]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/MassungZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/MassungZ15
Sean Massung, ChengXiang Zhai:
SyntacticDiff: Operator-based transformation for comparative text mining. IEEE BigData 2015: 571-580
[c206]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/ChoLGZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/ChoLGZ15
Jason H. D. Cho, Yanen Li, Roxana Girju, Chengxiang Zhai:
Recommending forum posts to designated experts. IEEE BigData 2015: 659-666
[c205]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/LourentzouDSZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/LourentzouDSZ15
Ismini Lourentzou, Graham Dyer, Abhishek Sharma, ChengXiang Zhai:
Hotspots of news articles: Joint mining of news text & social media to discover controversial points in news. IEEE BigData 2015: 2948-2950
[c204]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DuanZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DuanZ15
Huizhong Duan, ChengXiang Zhai:
Mining Coordinated Intent Representation for Entity Search and Recommendation. CIKM 2015: 333-342
[c203]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/HazimehZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/HazimehZ15
Hussein Hazimeh, ChengXiang Zhai:
Axiomatic Analysis of Smoothing Methods in Language Models for Pseudo-Relevance Feedback. ICTIR 2015: 141-150
[c202]
- view
  authority control:
- export record
  dblp key:
  - conf/icwe/LeginusZD15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwe/LeginusZD15
Martin Leginus, ChengXiang Zhai, Peter Dolog:
Beomap: Ad Hoc Topic Maps for Enhanced Exploration of Social Media Data. ICWE 2015: 200-218
[c201]
- view
  authority control:
- export record
  dblp key:
  - conf/ijcnn/QianZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnn/QianZ15
Mingjie Qian, ChengXiang Zhai:
Joint adaptive loss and l2/l0-norm minimization for unsupervised feature selection. IJCNN 2015: 1-8
[c200]
- view
  authority control:
- export record
  dblp key:
  - conf/sdm/ParkZG15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sdm/ParkZG15
Dae Hoon Park, ChengXiang Zhai, Lifan Guo:
SpecLDA: Modeling Product Reviews and Specifications to Generate Augmented Specifications. SDM 2015: 837-845
[c199]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ParkKZG15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ParkKZG15
Dae Hoon Park, Hyun Duk Kim, ChengXiang Zhai, Lifan Guo:
Retrieval of Relevant Opinion Sentences for New Products. SIGIR 2015: 393-402
[c198]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ParkLZW15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ParkLZW15
Dae Hoon Park, Mengwen Liu, ChengXiang Zhai, Haohong Wang:
Leveraging User Reviews to Improve Accuracy for Mobile App Retrieval. SIGIR 2015: 533-542
[c197]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Zhai15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Zhai15
ChengXiang Zhai:
Towards a Game-Theoretic Framework for Information Retrieval. SIGIR 2015: 543
[c196]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhangZ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhangZ15
Yinan Zhang, Chengxiang Zhai:
Information Retrieval as Card Playing: A Formal Model for Optimizing Interactive Retrieval Interface. SIGIR 2015: 685-694
[e6]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/2015
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/2015
James Allan, W. Bruce Croft, Arjen P. de Vries, Chengxiang Zhai:
Proceedings of the 2015 International Conference on The Theory of Information Retrieval, ICTIR 2015, Northampton, Massachusetts, USA, September 27-30, 2015. ACM 2015, ISBN 978-1-4503-3833-2 [contents]
2014
[j46]
- view
  authority control:
- export record
  dblp key:
  - journals/ese/TanLLWZZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ese/TanLLWZZ14
Lin Tan, Chen Liu, Zhenmin Li, Xuanhui Wang, Yuanyuan Zhou, ChengXiang Zhai:
Bug characteristics in open source software. Empir. Softw. Eng. 19(6): 1665-1705 (2014)
[j45]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/DingZCSWZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/DingZCSWZ14
Ying Ding, Guo Zhang, Tamy Chambers, Min Song, Xiaolong Wang, Chengxiang Zhai:
Content-based citation analysis: The next generation of citation analysis. J. Assoc. Inf. Sci. Technol. 65(9): 1820-1833 (2014)
[j44]
- view
  authority control:
- export record
  dblp key:
  - journals/kais/LiZC14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/kais/LiZC14
Yanen Li, ChengXiang Zhai, Ye Chen:
Exploiting rich user information for one-class collaborative filtering. Knowl. Inf. Syst. 38(2): 277-301 (2014)
[c195]
- view
  authority control:
- export record
  dblp key:
  - conf/bcb/ChoSZS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bcb/ChoSZS14
Jason H. D. Cho, Parikshit Sondhi, Chengxiang Zhai, Bruce R. Schatz:
Resolving healthcare forum posts via similar thread retrieval. BCB 2014: 33-42
[c194]
- view
  authority control:
- export record
  dblp key:
  - conf/bcb/ZhangCZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bcb/ZhangCZ14
Thomas Zhang, Jason H. D. Cho, Chengxiang Zhai:
Understanding user intents in online health forums. BCB 2014: 220-229
[c193]
- view
  authority control:
- export record
  dblp key:
  - conf/bcb/WangLFZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bcb/WangLFZ14
Sheng Wang, Yanen Li, Duncan C. Ferguson, Chengxiang Zhai:
SideEffectPTM: an unsupervised topic model to mine adverse drug reactions from health forums. BCB 2014: 321-330
[c192]
- view
  authority control:
- export record
  dblp key:
  - conf/bigdataconf/JiangZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bigdataconf/JiangZ14
Shan Jiang, ChengXiang Zhai:
Random walks on adjacency graphs for mining lexical relations from big text data. IEEE BigData 2014: 549-554
[c191]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/SondhiZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/SondhiZ14
Parikshit Sondhi, ChengXiang Zhai:
Mining Semi-Structured Online Knowledge Bases to Answer Natural Language Questions on Community QA Websites. CIKM 2014: 341-350
[c190]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LvZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LvZ14
Yuanhua Lv, ChengXiang Zhai:
Revisiting the Divergence Minimization Feedback Model. CIKM 2014: 1863-1866
[c189]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/QianZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/QianZ14
Mingjie Qian, ChengXiang Zhai:
Unsupervised Feature Selection for Multi-View Clustering on Text-Image Web News Data. CIKM 2014: 1963-1966
[c188]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/LiuWPZZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/LiuWPZZ14
Ke Liu, Junqiu Wu, Shengwen Peng, Chengxiang Zhai, Shanfeng Zhu:
The Fudan-UIUC Participation in the BioASQ Challenge Task 2a: The Antinomyra system. CLEF (Working Notes) 2014: 1311-1318
[c187]
- view
  authority control:
- export record
  dblp key:
  - conf/sdm/SondhiZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sdm/SondhiZ14
Parikshit Sondhi, ChengXiang Zhai:
A Constrained Hidden Markov Model Approach for Non-Explicit Citation Context Extraction. SDM 2014: 361-369
[c186]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/sigir/FangZ14a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FangZ14a
Hui Fang, ChengXiang Zhai:
VIRLab: A Platform for Privacy-Preserving Evaluation for Information Retrieval Models. PIR@SIGIR 2014: 37-38
[c185]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LiDWDCZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LiDWDCZ14
Yanen Li, Anlei Dong, Hongning Wang, Hongbo Deng, Yi Chang, ChengXiang Zhai:
A two-dimensional click model for query auto-completion. SIGIR 2014: 455-464
[c184]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FangWYZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FangWYZ14
Hui Fang, Hao Wu, Peilin Yang, ChengXiang Zhai:
VIRLab: a web-based virtual lab for learning and studying information retrieval models. SIGIR 2014: 1249-1250
[c183]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FangZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FangZ14
Hui Fang, ChengXiang Zhai:
Axiomatic analysis and optimization of information retrieval models. SIGIR 2014: 1288
[c182]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/WangZLDC14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/WangZLDC14
Hongning Wang, ChengXiang Zhai, Feng Liang, Anlei Dong, Yi Chang:
User modeling in search logs via a nonparametric bayesian approach. WSDM 2014: 203-212
[p4]
- view
  authority control:
- export record
  dblp key:
  - books/crc/aggarwal14/AggarwalZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/crc/aggarwal14/AggarwalZ14
Charu C. Aggarwal, ChengXiang Zhai:
Text Classification. Data Classification: Algorithms and Applications 2014: 287-336
[e5]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/2014
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/2014
Maarten de Rijke, Tom Kenter, Arjen P. de Vries, ChengXiang Zhai, Franciska de Jong, Kira Radinsky, Katja Hofmann:
Advances in Information Retrieval - 36th European Conference on IR Research, ECIR 2014, Amsterdam, The Netherlands, April 13-16, 2014. Proceedings. Lecture Notes in Computer Science 8416, Springer 2014, ISBN 978-3-319-06027-9 [contents]
2013
[j43]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/ShakeryZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/ShakeryZ13
Azadeh Shakery, ChengXiang Zhai:
Leveraging comparable corpora for cross-lingual information retrieval in resource-lean language pairs. Inf. Retr. 16(1): 1-29 (2013)
[j42]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/KarimzadehganZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/KarimzadehganZ13
Maryam Karimzadehgan, ChengXiang Zhai:
A learning approach to optimizing exploration-exploitation tradeoff in relevance feedback. Inf. Retr. 16(3): 307-330 (2013)
[j41]
- view
  authority control:
- export record
  dblp key:
  - journals/pvldb/DuanZCG13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/pvldb/DuanZCG13
Huizhong Duan, ChengXiang Zhai, Jinxing Cheng, Rohit Kumar:
Supporting Keyword Search in Product Database: A Probabilistic Approach. Proc. VLDB Endow. 6(14): 1786-1797 (2013)
[j40]
- view
  authority control:
- export record
  dblp key:
  - journals/sadm/ZhangZH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sadm/ZhangZH13
Duo Zhang, ChengXiang Zhai, Jiawei Han:
MiTexCube: MicroTextCluster Cube for online analysis of text cells and its applications. Stat. Anal. Data Min. 6(3): 243-259 (2013)
[c181]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/GanesanZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/GanesanZ13
Kavita Ganesan, ChengXiang Zhai:
FindiLike: a preference driven entity search engine for evaluating entity retrieval and opinion summarization. LivingLab@CIKM 2013: 19-22
[c180]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WangYLZH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WangYLZH13
Chi Wang, Xiao Yu, Yanen Li, Chengxiang Zhai, Jiawei Han:
Content coverage maximization on word networks for hierarchical topic summarization. CIKM 2013: 249-258
[c179]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LiHZW13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LiHZW13
Yanen Li, Bo-June Paul Hsu, ChengXiang Zhai, Kuansan Wang:
Mining entity attribute synonyms via compact clustering. CIKM 2013: 867-872
[c178]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KimCHZRD13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KimCHZRD13
Hyun Duk Kim, Malú Castellanos, Meichun Hsu, ChengXiang Zhai, Thomas A. Rietz, Daniel Diermeier:
Mining causal topics in text data: iterative topic modeling with time series feedback. CIKM 2013: 885-890
[c177]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KimCHZDG13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KimCHZDG13
Hyun Duk Kim, Malú Castellanos, Meichun Hsu, ChengXiang Zhai, Umeshwar Dayal, Riddhiman Ghosh:
Compact explanatory opinion summarization. CIKM 2013: 1697-1702
[c176]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LiHZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LiHZ13
Yanen Li, Bo-June Paul Hsu, ChengXiang Zhai:
Unsupervised identification of synonymous query intent templates for attribute intents. CIKM 2013: 2029-2038
[c175]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DuanZCG13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DuanZCG13
Huizhong Duan, ChengXiang Zhai, Jinxing Cheng, Rohit Kumar:
A probabilistic mixture model for mining and analyzing product search log. CIKM 2013: 2179-2188
[c174]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/ZhaiF13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/ZhaiF13
ChengXiang Zhai, Hui Fang:
Axiomatic Analysis and Optimization of Information Retrieval Models. ICTIR 2013: 3
[c173]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/KimNZCH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/KimNZCH13
Hyun Duk Kim, Danila Nikitin, ChengXiang Zhai, Malú Castellanos, Meichun Hsu:
Information Retrieval with Time Series Query. ICTIR 2013: 14
[c172]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/PattabiramanSZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/PattabiramanSZ13
Kumaresh Pattabiraman, Parikshit Sondhi, ChengXiang Zhai:
Exploiting Forum Thread Structures to Improve Thread Clustering. ICTIR 2013: 15
[c171]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/KarimzadehganZE13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/KarimzadehganZE13
Maryam Karimzadehgan, ChengXiang Zhai, Miles Efron:
Statistical Translation Language Model for Twitter Search. ICTIR 2013: 26
[c170]
- view
- export record
  dblp key:
  - conf/ijcai/QianZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/QianZ13
Mingjie Qian, Chengxiang Zhai:
Robust Unsupervised Feature Selection. IJCAI 2013: 1621-1627
[c169]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/WangZR13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/WangZR13
Xiaolong Wang, Chengxiang Zhai, Dan Roth:
Understanding evolution of research themes: a probabilistic generative model for citations. KDD 2013: 1115-1123
[c168]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/TaoLHZCDDDGJKKLLLLOSTWZZ13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/TaoLHZCDDDGJKKLLLLOSTWZZ13
Fangbo Tao, Kin Hou Lei, Jiawei Han, Chengxiang Zhai, Xiao Cheng, Marina Danilevsky, Nihit Desai, Bolin Ding, Jing Ge, Heng Ji, Rucha Kanade, Anne Kao, Qi Li, Yanen Li, Cindy Xide Lin, Jialu Liu, Nikunj C. Oza, Ashok N. Srivastava, Rodney Tjoelker, Chi Wang, Duo Zhang, Bo Zhao:
EventCube: multi-dimensional search and mining of structured and text data. KDD 2013: 1494-1497
[c167]
- view
  authority control:
- export record
  dblp key:
  - conf/semco/MassungZH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semco/MassungZH13
Sean Massung, Chengxiang Zhai, Julia Hockenmaier:
Structural Parse Tree Features for Text Representation. ICSC 2013: 9-16
[c166]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KimCHZDG13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KimCHZDG13
Hyun Duk Kim, Malú Castellanos, Meichun Hsu, ChengXiang Zhai, Umeshwar Dayal, Riddhiman Ghosh:
Ranking explanatory sentences for opinion summarization. SIGIR 2013: 1069-1072
[c165]
- view
  authority control:
- export record
  dblp key:
  - conf/www/WangZDC13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/WangZDC13
Hongning Wang, ChengXiang Zhai, Anlei Dong, Yi Chang:
Content-aware click modeling. WWW 2013: 1365-1376
2012
[j39]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/KarimzadehganZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/KarimzadehganZ12
Maryam Karimzadehgan, ChengXiang Zhai:
Integer linear programming for Constrained Multi-Aspect Committee Review Assignment. Inf. Process. Manag. 48(4): 725-740 (2012)
[j38]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/GanesanZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/GanesanZ12
Kavita Ganesan, ChengXiang Zhai:
Opinion-based entity ranking. Inf. Retr. 15(2): 116-150 (2012)
[j37]
- view
  authority control:
- export record
  dblp key:
  - journals/jamia/SondhiSZSK12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jamia/SondhiSZSK12
Parikshit Sondhi, Jimeng Sun, ChengXiang Zhai, Robert Sorrentino, Martin S. Kohn:
Leveraging medical thesauri and physician feedback for improving medical literature retrieval for case queries. J. Am. Medical Informatics Assoc. 19(5): 851-858 (2012)
[c164]
- view
  authority control:
- export record
  dblp key:
  - conf/asist/0001GZ012
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asist/0001GZ012
Manish Gupta, Jing Gao, ChengXiang Zhai, Jiawei Han:
Predicting future popularity trend of events in microblogging platforms. ASIST 2012: 1-10
[c163]
- view
  authority control:
- export record
  dblp key:
  - conf/asist/KimPLZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asist/KimPLZ12
Hyun Duk Kim, Dae Hoon Park, Yue Lu, ChengXiang Zhai:
Enriching text representation with frequent pattern mining for probabilistic topic modeling. ASIST 2012: 1-10
[c162]
- view
  authority control:
- export record
  dblp key:
  - conf/asist/VydiswaranZRP12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asist/VydiswaranZRP12
V. G. Vinod Vydiswaran, ChengXiang Zhai, Dan Roth, Peter Pirolli:
Unbiased learning of controversial topics. ASIST 2012: 1-4
[c161]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DuanKZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DuanKZ12
Huizhong Duan, Emre Kiciman, ChengXiang Zhai:
Click patterns: an empirical representation of complex query intents. CIKM 2012: 1035-1044
[c160]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/TanLZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/TanLZ12
Bin Tan, Yuanhua Lv, ChengXiang Zhai:
Mining long-lasting exploratory user interests from search history. CIKM 2012: 1477-1481
[c159]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LuWZR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LuWZR12
Yue Lu, Hongning Wang, ChengXiang Zhai, Dan Roth:
Unsupervised discovery of opposing opinion networks from forum discussions. CIKM 2012: 1642-1646
[c158]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LvZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LvZ12
Yuanhua Lv, ChengXiang Zhai:
Query likelihood with negative query generation. CIKM 2012: 1799-1803
[c157]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/VydiswaranZRP12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/VydiswaranZRP12
V. G. Vinod Vydiswaran, ChengXiang Zhai, Dan Roth, Peter Pirolli:
BiasTrust: teaching biased users about controversial topics. CIKM 2012: 1905-1909
[c156]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KimZRDHCL12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KimZRDHCL12
Hyun Duk Kim, ChengXiang Zhai, Thomas A. Rietz, Daniel Diermeier, Meichun Hsu, Malú Castellanos, Carlos Ceja Limon:
InCaToMi: integrative causal topic miner between textual and non-textual time series data. CIKM 2012: 2689-2691
[c155]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SondhiVZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SondhiVZ12
Parikshit Sondhi, V. G. Vinod Vydiswaran, ChengXiang Zhai:
Reliability Prediction of Webpages in the Medical Domain. ECIR 2012: 219-231
[c154]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/LvZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/LvZ12
Yuanhua Lv, ChengXiang Zhai:
A Log-Logistic Model-Based Interpretation of TF Normalization of BM25. ECIR 2012: 244-255
[c153]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/GeraniZC12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/GeraniZC12
Shima Gerani, ChengXiang Zhai, Fabio Crestani:
Score Transformation in Linear Combination for Multi-criteria Relevance Ranking. ECIR 2012: 256-267
[c152]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/KarimzadehganZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/KarimzadehganZ12
Maryam Karimzadehgan, ChengXiang Zhai:
Axiomatic Analysis of Translation Language Model for Information Retrieval. ECIR 2012: 268-280
[c151]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/emnlp/DuanLZR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/DuanLZR12
Huizhong Duan, Yanen Li, ChengXiang Zhai, Dan Roth:
A Discriminative Model for Query Spelling Correction with Latent Structural SVM. EMNLP-CoNLL 2012: 1511-1521
[c150]
- view
  authority control:
- export record
  dblp key:
  - conf/ht/WeningerZH12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ht/WeningerZH12
Tim Weninger, ChengXiang Zhai, Jiawei Han:
Building enriched web page representations using link paths. HT 2012: 53-62
[c149]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/SondhiSTZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/SondhiSTZ12
Parikshit Sondhi, Jimeng Sun, Hanghang Tong, ChengXiang Zhai:
SympGraph: a framework for mining clinical notes through symptom relation graphs. KDD 2012: 1167-1175
[c148]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LiDZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LiDZ12
Yanen Li, Huizhong Duan, ChengXiang Zhai:
A generalized hidden Markov model with discriminative training for query spelling correction. SIGIR 2012: 611-620
[c147]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/KotovZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/KotovZ12
Alexander Kotov, ChengXiang Zhai:
Tapping into knowledge base for concept feedback: leveraging conceptnet to improve search results for difficult queries. WSDM 2012: 403-412
[c146]
- view
  authority control:
- export record
  dblp key:
  - conf/www/GanesanZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/GanesanZ12
Kavita Ganesan, ChengXiang Zhai:
FindiLike: preference driven entity search. WWW (Companion Volume) 2012: 345-348
[c145]
- view
  authority control:
- export record
  dblp key:
  - conf/www/LiDZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/LiDZ12
Yanen Li, Huizhong Duan, ChengXiang Zhai:
CloudSpeller: query spelling correction by using a unified hidden markov model with web-scale resources. WWW (Companion Volume) 2012: 561-562
[c144]
- view
  authority control:
- export record
  dblp key:
  - conf/www/GanesanZV12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/GanesanZV12
Kavita Ganesan, ChengXiang Zhai, Evelyne Viegas:
Micropinion generation: an unsupervised approach to generating ultra-concise summaries of opinions. WWW 2012: 869-878
[p3]
- view
  authority control:
- export record
  dblp key:
  - books/sp/mining2012/AggarwalZ12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/mining2012/AggarwalZ12
Charu C. Aggarwal, ChengXiang Zhai:
An Introduction to Text Mining. Mining Text Data 2012: 1-10
[p2]
- view
  authority control:
- export record
  dblp key:
  - books/sp/mining2012/AggarwalZ12a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/mining2012/AggarwalZ12a
Charu C. Aggarwal, ChengXiang Zhai:
A Survey of Text Clustering Algorithms. Mining Text Data 2012: 77-128
[p1]
- view
  authority control:
- export record
  dblp key:
  - books/sp/mining2012/AggarwalZ12b
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/mining2012/AggarwalZ12b
Charu C. Aggarwal, ChengXiang Zhai:
A Survey of Text Classification Algorithms. Mining Text Data 2012: 163-222
[e4]
- view
  - table of contents in dblp
  - details & citations
- export record
  dblp key:
  - books/sp/mining12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/mining12
Charu C. Aggarwal, ChengXiang Zhai:
Mining Text Data. Springer 2012, ISBN 978-1-4419-8462-3 [contents]
[i5]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1212-2478
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1212-2478
Rong Jin, Luo Si, ChengXiang Zhai:
Preference-based Graphic Models for Collaborative Filtering. CoRR abs/1212.2478 (2012)
2011
[j36]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/LuMZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/LuMZ11
Yue Lu, Qiaozhu Mei, ChengXiang Zhai:
Investigating task performance of probabilistic topic models: an empirical study of PLSA and LDA. Inf. Retr. 14(2): 178-203 (2011)
[j35]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/nar/SarmaAKCLHJMZS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nar/SarmaAKCLHJMZS11
Moushumi Sen Sarma, David Arcoleo, Radhika S. Khetani, Brant W. Chee, Xu Ling, Xin He, Jing Jiang, Qiaozhu Mei, ChengXiang Zhai, Bruce R. Schatz:
BeeSpace Navigator: exploratory analysis of gene function using semantic indexing of biological literature. Nucleic Acids Res. 39(Web-Server-Issue): 462-469 (2011)
[j34]
- view
  authority control:
- export record
  dblp key:
  - journals/tkde/DingZLHZSO11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tkde/DingZLHZSO11
Bolin Ding, Bo Zhao, Cindy Xide Lin, Jiawei Han, Chengxiang Zhai, Ashok N. Srivastava, Nikunj C. Oza:
Efficient Keyword-Based Search for Top-K Cells in Text Cube. IEEE Trans. Knowl. Data Eng. 23(12): 1795-1810 (2011)
[j33]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/FangTZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/FangTZ11
Hui Fang, Tao Tao, ChengXiang Zhai:
Diagnostic Evaluation of Information Retrieval Models. ACM Trans. Inf. Syst. 29(2): 7:1-7:42 (2011)
[c143]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/acl/WangZZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/WangZZ11
Hongning Wang, Duo Zhang, ChengXiang Zhai:
Structural Topic Model for Latent Topical Structure Analysis. ACL 2011: 1526-1535
[c142]
- view
  - electronic edition @ nasa.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/cidu/ZhangZH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cidu/ZhangZH11
Duo Zhang, ChengXiang Zhai, Jiawei Han:
MiTexCube: MicroTextCluster Cube for Online Analysis of Text Cells. CIDU 2011: 204-218
[c141]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LvZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LvZ11
Yuanhua Lv, ChengXiang Zhai:
Lower-bounding term frequency normalization. CIKM 2011: 7-16
[c140]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KarimzadehganZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KarimzadehganZ11
Maryam Karimzadehgan, ChengXiang Zhai:
Improving retrieval accuracy of difficult queries through generalizing negative document language models. CIKM 2011: 27-36
[c139]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KotovZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KotovZ11
Alexander Kotov, ChengXiang Zhai:
Interactive sense feedback for difficult queries. CIKM 2011: 163-172
[c138]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LvZ11a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LvZ11a
Yuanhua Lv, ChengXiang Zhai:
Adaptive term frequency normalization for BM25. CIKM 2011: 1985-1988
[c137]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DuanLZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DuanLZ11
Huizhong Duan, Rui Li, ChengXiang Zhai:
Automatic query reformulation with syntactic operators to alleviate search difficulty. CIKM 2011: 2037-2040
[c136]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/DuanZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/DuanZ11
Huizhong Duan, Chengxiang Zhai:
Exploiting Thread Structures to Improve Smoothing of Language Models for Forum Post Retrieval. ECIR 2011: 350-361
[c135]
- view
  authority control:
- export record
  dblp key:
  - conf/icdm/YinCHZH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icdm/YinCHZH11
Zhijun Yin, Liangliang Cao, Jiawei Han, Chengxiang Zhai, Thomas S. Huang:
LPTA: A Probabilistic Model for Latent Periodic Topic Analysis. ICDM 2011: 904-913
[c134]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/ictir/Zhai11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/Zhai11
ChengXiang Zhai:
Axiomatic Analysis and Optimization of Information Retrieval Models. ICTIR 2011: 1
[c133]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/WangLZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/WangLZ11
Hongning Wang, Yue Lu, ChengXiang Zhai:
Latent aspect rating analysis without aspect keyword supervision. KDD 2011: 618-626
[c132]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/VydiswaranZR11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/VydiswaranZR11
V. G. Vinod Vydiswaran, ChengXiang Zhai, Dan Roth:
Content-driven trust propagation framework. KDD 2011: 974-982
[c131]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Zhai11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Zhai11
ChengXiang Zhai:
Beyond search: statistical topic models for text analysis. SIGIR 2011: 3-4
[c130]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LvZC11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LvZC11
Yuanhua Lv, ChengXiang Zhai, Wan Chen:
A boosting approach to improving pseudo-relevance feedback. SIGIR 2011: 165-174
[c129]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LiHZW11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LiHZW11
Yanen Li, Bo-June Paul Hsu, ChengXiang Zhai, Kuansan Wang:
Unsupervised query segmentation using clickthrough for information retrieval. SIGIR 2011: 285-294
[c128]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/WangWZH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/WangWZH11
Hongning Wang, Chi Wang, ChengXiang Zhai, Jiawei Han:
Learning online discussion structures by conditional random fields. SIGIR 2011: 435-444
[c127]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LvZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LvZ11
Yuanhua Lv, ChengXiang Zhai:
When documents are very long, BM25 fails! SIGIR 2011: 1103-1104
[c126]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/KotovZS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/KotovZS11
Alexander Kotov, ChengXiang Zhai, Richard Sproat:
Mining named entities with temporally correlated bursts from multilingual web news streams. WSDM 2011: 237-246
[c125]
- view
  authority control:
- export record
  dblp key:
  - conf/www/YinCHZH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/YinCHZH11
Zhijun Yin, Liangliang Cao, Jiawei Han, Chengxiang Zhai, Thomas S. Huang:
Geographical topic discovery and comparison. WWW 2011: 247-256
[c124]
- view
  authority control:
- export record
  dblp key:
  - conf/www/LuCDZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/LuCDZ11
Yue Lu, Malú Castellanos, Umeshwar Dayal, ChengXiang Zhai:
Automatic construction of a context-aware sentiment lexicon: an optimization approach. WWW 2011: 347-356
[d1]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - data/10/GanesanZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/data/10/GanesanZ11
Kavita Ganesan, ChengXiang Zhai:
OpinRank Review Dataset. UCI Machine Learning Repository, 2011
2010
[j32]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/bmcbi/HeSLCZS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bmcbi/HeSLCZS10
Xin He, Moushumi Sen Sarma, Xu Ling, Brant W. Chee, Chengxiang Zhai, Bruce R. Schatz:
Identifying overrepresented concepts in gene lists from literature: a statistical approach based on Poisson mixture model. BMC Bioinform. 11: 272 (2010)
[j31]
- view
  authority control:
- export record
  dblp key:
  - journals/ijbra/KoZR10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijbra/KoZR10
Younhee Ko, ChengXiang Zhai, Sandra L. Rodriguez-Zas:
Discovery of gene network variability across samples representing multiple classes. Int. J. Bioinform. Res. Appl. 6(4): 402-417 (2010)
[j30]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/LiuJLZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/LiuJLZ10
Tie-Yan Liu, Thorsten Joachims, Hang Li, Chengxiang Zhai:
Introduction to special issue on learning to rank for information retrieval. Inf. Retr. 13(3): 197-200 (2010)
[j29]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/nar/HeLKSLLZS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nar/HeLKSLLZS10
Xin He, Yanen Li, Radhika S. Khetani, Barry Sanders, Yue Lu, Xu Ling, ChengXiang Zhai, Bruce R. Schatz:
BSQA: integrated text mining using entity relation semantics extracted from biological literature of insects. Nucleic Acids Res. 38(Web-Server-Issue): 175-181 (2010)
[j28]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/ZhaiWYVV10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/ZhaiWYVV10
Chengxiang Zhai, Kuansan Wang, David Yarowsky, Stephan Vogel, Evelyne Viegas:
Web N-gram workshop 2010. SIGIR Forum 44(2): 59-63 (2010)
[c123]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/acl/ZhangMZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/ZhangMZ10
Duo Zhang, Qiaozhu Mei, ChengXiang Zhai:
Cross-Lingual Latent Topic Extraction. ACL 2010: 1128-1137
[c122]
- view
  - electronic edition @ nasa.gov
  - details & citations
- export record
  dblp key:
  - conf/cidu/DingYZLHZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cidu/DingYZLHZ10
Bolin Ding, Yintao Yu, Bo Zhao, Cindy Xide Lin, Jiawei Han, Chengxiang Zhai:
Keyword Search in Text Cube: Finding Top-k Aggregated Cell Documents. CIDU 2010: 145-159
[c121]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LiHZC10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LiHZC10
Yanen Li, Jia Hu, ChengXiang Zhai, Ye Chen:
Improving one-class collaborative filtering by incorporating rich user information. CIKM 2010: 959-968
[c120]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KarimzadehganZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KarimzadehganZ10
Maryam Karimzadehgan, ChengXiang Zhai:
Exploration-exploitation tradeoff in interactive relevance feedback. CIKM 2010: 1397-1400
[c119]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ZhangSZBA10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ZhangSZBA10
Duo Zhang, Jimeng Sun, ChengXiang Zhai, Abhijit Bose, Nikos Anerousis:
PTM: probabilistic topic mapping model for mining parallel document collections. CIKM 2010: 1653-1656
[c118]
- view
- export record
  dblp key:
  - conf/clef/SondhiSZSKEL10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/SondhiSZSKEL10
Parikshit Sondhi, Jimeng Sun, ChengXiang Zhai, Robert Sorrentino, Martin S. Kohn, Shahram Ebadollahi, Yanen Li:
Medical Case-based Retrieval by Leveraging Medical Ontology and Physician Feedback: UIUC-IBM at ImageCLEF 2010. CLEF (Notebook Papers/LABs/Workshops) 2010
[c117]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/coling/GanesanZH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/GanesanZH10
Kavita Ganesan, ChengXiang Zhai, Jiawei Han:
Opinosis: A Graph Based Approach to Abstractive Summarization of Highly Redundant Opinions. COLING 2010: 340-348
[c116]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/coling/LuDWZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/LuDWZ10
Yue Lu, Huizhong Duan, Hongning Wang, ChengXiang Zhai:
Exploiting Structured Ontology to Organize Scattered Online Opinions. COLING 2010: 734-742
[c115]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/coling/SondhiGZH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/SondhiGZH10
Parikshit Sondhi, Manish Gupta, ChengXiang Zhai, Julia Hockenmaier:
Shallow Information Extraction from Medical Forum Data. COLING (Posters) 2010: 1158-1166
[c114]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/KimZH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/KimZH10
Hyun Duk Kim, ChengXiang Zhai, Jiawei Han:
Aggregation of Multiple Judgments for Evaluating Ordered Lists. ECIR 2010: 166-178
[c113]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/emnlp/PaulZG10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/PaulZG10
Michael J. Paul, ChengXiang Zhai, Roxana Girju:
Summarizing Contrastive Viewpoints in Opinionated Text. EMNLP 2010: 66-76
[c112]
- view
  authority control:
- export record
  dblp key:
  - conf/icde/DingZLHZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icde/DingZLHZ10
Bolin Ding, Bo Zhao, Cindy Xide Lin, Jiawei Han, Chengxiang Zhai:
TopCells: Keyword-based search of top-k aggregated documents in text cube. ICDE 2010: 381-384
[c111]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/WangLZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/WangLZ10
Hongning Wang, Yue Lu, Chengxiang Zhai:
Latent aspect rating analysis on review text data: a rating regression approach. KDD 2010: 783-792
[c110]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KarimzadehganZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KarimzadehganZ10
Maryam Karimzadehgan, ChengXiang Zhai:
Estimation of statistical translation models based on mutual information for ad hoc information retrieval. SIGIR 2010: 323-330
[c109]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LvZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LvZ10
Yuanhua Lv, ChengXiang Zhai:
Positional relevance model for pseudo-relevance feedback. SIGIR 2010: 579-586
[c108]
- view
  authority control:
- export record
  dblp key:
  - conf/www/KotovZ10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/KotovZ10
Alexander Kotov, ChengXiang Zhai:
Towards natural question guided search. WWW 2010: 541-550

2000 – 2009

see FAQ

What is the meaning of the colors in the publication lists?

2009
[j27]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/bmcsb/KoZR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bmcsb/KoZR09
Younhee Ko, ChengXiang Zhai, Sandra L. Rodriguez-Zas:
Inference of gene pathways using mixture Bayesian networks. BMC Syst. Biol. 3: 54 (2009)
[j26]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/LuFZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/LuFZ09
Yue Lu, Hui Fang, Chengxiang Zhai:
An empirical study of gene synonym query expansion in biomedical information retrieval. Inf. Retr. 12(1): 51-68 (2009)
[j25]
- view
  authority control:
- export record
  dblp key:
  - journals/pvldb/YuLSCHLWZZZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/pvldb/YuLSCHLWZZZ09
Yintao Yu, Cindy Xide Lin, Yizhou Sun, Chen Chen, Jiawei Han, Binbin Liao, Tianyi Wu, ChengXiang Zhai, Duo Zhang, Bo Zhao:
iNextCube: Information Network-Enhanced Text Cube. Proc. VLDB Endow. 2(2): 1622-1625 (2009)
[j24]
- view
  authority control:
- export record
  dblp key:
  - journals/sadm/ZhangZHSO09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sadm/ZhangZHSO09
Duo Zhang, ChengXiang Zhai, Jiawei Han, Ashok N. Srivastava, Nikunj C. Oza:
Topic modeling for OLAP on multidimensional text databases: topic cube and its applications. Stat. Anal. Data Min. 2(5-6): 378-395 (2009)
[j23]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/LiLZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/LiLZ09
Hang Li, Tie-Yan Liu, ChengXiang Zhai:
Learning to rank for information retrieval (LR4IR 2009). SIGIR Forum 43(2): 41-45 (2009)
[c107]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LvZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LvZ09
Yuanhua Lv, ChengXiang Zhai:
Adaptive relevance feedback in information retrieval. CIKM 2009: 255-264
[c106]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KimZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KimZ09
Hyun Duk Kim, ChengXiang Zhai:
Generating comparative summaries of contradictory opinions in text. CIKM 2009: 385-394
[c105]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WangTSZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WangTSZ09
Xuanhui Wang, Bin Tan, Azadeh Shakery, ChengXiang Zhai:
Beyond hyperlinks: organizing information footprints in search logs to support effective browsing. CIKM 2009: 1237-1246
[c104]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KarimzadehganZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KarimzadehganZ09
Maryam Karimzadehgan, ChengXiang Zhai:
Constrained multi-aspect expertise matching for committee review assignment. CIKM 2009: 1697-1700
[c103]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LvZ09a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LvZ09a
Yuanhua Lv, ChengXiang Zhai:
A comparative study of methods for estimating query language models with pseudo feedback. CIKM 2009: 1895-1898
[c102]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/HeZL09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/HeZL09
Jing He, Chengxiang Zhai, Xiaoming Li:
Evaluation of methods for relative comparison of retrieval systems based on clickthroughs. CIKM 2009: 2029-2032
[c101]
- view
  authority control:
- export record
  dblp key:
  - conf/icdm/HauguelZH09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icdm/HauguelZH09
Samson Hauguel, ChengXiang Zhai, Jiawei Han:
Parallel PathFinder Algorithms for Mining Structures from Graphs. ICDM 2009: 812-817
[c100]
- view
  authority control:
- export record
  dblp key:
  - conf/isi/FininJKYSBLCSTKBBKHZSXMA09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/isi/FininJKYSBLCSTKBBKHZSXMA09
Tim Finin, Anupam Joshi, Hillol Kargupta, Yelena Yesha, Joel Sachs, Elisa Bertino, Ninghui Li, Chris Clifton, Gene Spafford, Bhavani Thuraisingham, Murat Kantarcioglu, Alain Bensoussan, Nathan Berg, Latifur Khan, Jiawei Han, ChengXiang Zhai, Ravi S. Sandhu, Shouhuai Xu, Jim Massaro, Lada A. Adamic:
Assured Information Sharing Life Cycle. ISI 2009: 307-309
[c99]
- view
  authority control:
- export record
  dblp key:
  - conf/sdm/ZhangZH09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sdm/ZhangZH09
Duo Zhang, ChengXiang Zhai, Jiawei Han:
Topic Cube: Topic Modeling for OLAP on Multidimensional Text Databases. SDM 2009: 1124-1135
[c98]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LvZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LvZ09
Yuanhua Lv, ChengXiang Zhai:
Positional language models for information retrieval. SIGIR 2009: 299-306
[c97]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/sigir/WangZ09a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/WangZ09a
Xuanhui Wang, ChengXiang Zhai:
Massive Implicit Feedback: Organizing Search Logs into Topic Maps for Collaborative Surfing. UIIR@SIGIR 2009
[c96]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/LvHVGZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/LvHVGZ09
Yuanhua Lv, Jing He, V. G. Vinod Vydiswaran, Kavita Ganesan, ChengXiang Zhai:
A Study of Term Proximity and Document Weighting Normalization in Pseudo Relevance Feedback--UIUC at TREC 2009 Million Query Track. TREC 2009
[c95]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/VydiswaranGLHZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/VydiswaranGLHZ09
V. G. Vinod Vydiswaran, Kavita Ganesan, Yuanhua Lv, Jing He, ChengXiang Zhai:
Finding Related Entities by Retrieving Relations: UIUC at TREC 2009 Entity Track. TREC 2009
[c94]
- view
  authority control:
- export record
  dblp key:
  - conf/um/ShenZB09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/um/ShenZB09
Xuehua Shen, ChengXiang Zhai, Nicholas J. Belkin:
Adaptive Clustering of Search Results. UMAP 2009: 447-453
[c93]
- view
  authority control:
- export record
  dblp key:
  - conf/www/LuZS09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/LuZS09
Yue Lu, ChengXiang Zhai, Neel Sundaresan:
Rated aspect summarization of short comments. WWW 2009: 131-140
[e3]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/2009
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/2009
James Allan, Javed A. Aslam, Mark Sanderson, ChengXiang Zhai, Justin Zobel:
Proceedings of the 32nd Annual International ACM SIGIR Conference on Research and Development in Information Retrieval, SIGIR 2009, Boston, MA, USA, July 19-23, 2009. ACM 2009, ISBN 978-1-60558-483-6 [contents]
[r2]
- view
  authority control:
- export record
  dblp key:
  - reference/db/FangZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/db/FangZ09
Hui Fang, ChengXiang Zhai:
Web Search Relevance Feedback. Encyclopedia of Database Systems 2009: 3493-3497
[r1]
- view
  authority control:
- export record
  dblp key:
  - reference/db/ShenZ09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/db/ShenZ09
Xuehua Shen, ChengXiang Zhai:
Web Search Result De-duplication and Clustering. Encyclopedia of Database Systems 2009: 3506-3510
2008
[b1]
- view
  authority control:
- export record
  dblp key:
  - series/synthesis/2008Zhai
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/synthesis/2008Zhai
ChengXiang Zhai:
Statistical Language Models for Information Retrieval. Synthesis Lectures on Human Language Technologies, Morgan & Claypool Publishers 2008, ISBN 978-3-031-01002-6
[j22]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/bmcbi/JinMZL08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bmcbi/JinMZL08
Bo Jin, Brian Muller, Chengxiang Zhai, Xinghua Lu:
Multi-label literature classification based on the Gene Ontology graph. BMC Bioinform. 9 (2008)
[j21]
- view
  authority control:
- export record
  dblp key:
  - journals/ftir/Zhai08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ftir/Zhai08
ChengXiang Zhai:
Statistical Language Models for Information Retrieval: A Critical Review. Found. Trends Inf. Retr. 2(3): 137-213 (2008)
[j20]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/ShakeryZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/ShakeryZ08
Azadeh Shakery, ChengXiang Zhai:
Smoothing document language models with probabilistic term count propagation. Inf. Retr. 11(2): 139-164 (2008)
[j19]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/LiLZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/LiLZ08
Hang Li, Tie-Yan Liu, ChengXiang Zhai:
Learning to rank for information retrieval (LR4IR 2008). SIGIR Forum 42(2): 76-79 (2008)
[j18]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/WangTSSZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/WangTSSZ08
Xuanhui Wang, Tao Tao, Jian-Tao Sun, Azadeh Shakery, Chengxiang Zhai:
DirichletRank: Solving the zero-one gap problem of PageRank. ACM Trans. Inf. Syst. 26(2): 10:1-10:29 (2008)
[c92]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/acl/MeiZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/MeiZ08
Qiaozhu Mei, ChengXiang Zhai:
Generating Impact-Based Summaries for Scientific Literature. ACL 2008: 816-824
[c91]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WangZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WangZ08
Xuanhui Wang, ChengXiang Zhai:
Mining term association patterns from search logs for effective query reformulation. CIKM 2008: 479-488
[c90]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/CaiMHZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/CaiMHZ08
Deng Cai, Qiaozhu Mei, Jiawei Han, Chengxiang Zhai:
Modeling hidden topics on document manifold. CIKM 2008: 911-920
[c89]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/KarimzadehganZB08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/KarimzadehganZB08
Maryam Karimzadehgan, ChengXiang Zhai, Geneva G. Belford:
Multi-aspect expertise matching for review assignment. CIKM 2008: 1113-1122
[c88]
- view
  authority control:
- export record
  dblp key:
  - conf/dasfaa/AgarwalMTZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dasfaa/AgarwalMTZ08
Ganesh Agarwal, Nevedita Mallick, Srinivasan Turuvekere, ChengXiang Zhai:
Ranking Database Queries with User Feedback: A Neural Network Approach. DASFAA 2008: 424-431
[c87]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/LingMZS08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/LingMZS08
Xu Ling, Qiaozhu Mei, ChengXiang Zhai, Bruce R. Schatz:
Mining multi-faceted overviews of arbitrary topics in a text collection. KDD 2008: 497-505
[c86]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/WangFZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/WangFZ08
Xuanhui Wang, Hui Fang, ChengXiang Zhai:
A study of methods for negative relevance feedback. SIGIR 2008: 219-226
[c85]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/MeiZZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/MeiZZ08
Qiaozhu Mei, Duo Zhang, ChengXiang Zhai:
A general optimization framework for smoothing language models on graph structures. SIGIR 2008: 611-618
[c84]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/LvZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/LvZ08
Yuanhua Lv, ChengXiang Zhai:
A Study of Adaptive Relevance Feedback - UIUC TREC 2008 Relevance Feedback Experiments. TREC 2008
[c83]
- view
  authority control:
- export record
  dblp key:
  - conf/www/MeiCZZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/MeiCZZ08
Qiaozhu Mei, Deng Cai, Duo Zhang, ChengXiang Zhai:
Topic modeling with network regularization. WWW 2008: 101-110
[c82]
- view
  authority control:
- export record
  dblp key:
  - conf/www/LuZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/LuZ08
Yue Lu, Chengxiang Zhai:
Opinion integration through semi-supervised topic modeling. WWW 2008: 121-130
[i4]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/tac/KimPVZ08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/KimPVZ08
Hyun Duk Kim, Dae Hoon Park, V. G. Vinod Vydiswaran, ChengXiang Zhai:
Opinion Summarization Using Entity Features and Probabilistic Sentence Coherence Optimization: UIUC at TAC 2008 Opinion Summarization Pilot. TAC 2008
2007
[j17]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/LingJHMZS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/LingJHMZS07
Xu Ling, Jing Jiang, Xin He, Qiaozhu Mei, Chengxiang Zhai, Bruce R. Schatz:
Generating gene summaries from biomedical literature: A study of semi-structured summarization. Inf. Process. Manag. 43(6): 1777-1791 (2007)
[j16]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/JiangZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/JiangZ07
Jing Jiang, ChengXiang Zhai:
An empirical study of tokenization strategies for biomedical information retrieval. Inf. Retr. 10(4-5): 341-363 (2007)
[j15]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/ShenTZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/ShenTZ07
Xuehua Shen, Bin Tan, ChengXiang Zhai:
Privacy protection in personalized search. SIGIR Forum 41(1): 4-17 (2007)
[j14]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CallanACDESZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CallanACDESZ07
Jamie Callan, James Allan, Charles L. A. Clarke, Susan T. Dumais, David A. Evans, Mark Sanderson, ChengXiang Zhai:
Meeting of the MINDS: an information retrieval research agenda. SIGIR Forum 41(2): 25-34 (2007)
[j13]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/JoachimsLLZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/JoachimsLLZ07
Thorsten Joachims, Hang Li, Tie-Yan Liu, ChengXiang Zhai:
Learning to rank for information retrieval (LR4IR 2007). SIGIR Forum 41(2): 58-62 (2007)
[j12]
- view
  authority control:
- export record
  dblp key:
  - journals/tkdd/MeiXCHZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tkdd/MeiXCHZ07
Qiaozhu Mei, Dong Xin, Hong Cheng, Jiawei Han, Chengxiang Zhai:
Semantic annotation of frequent patterns. ACM Trans. Knowl. Discov. Data 1(3): 11 (2007)
[c81]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/acl/JiangZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/JiangZ07
Jing Jiang, ChengXiang Zhai:
Instance Weighting for Domain Adaptation in NLP. ACL 2007
[c80]
- view
  authority control:
- export record
  dblp key:
  - conf/bibm/KoZR07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bibm/KoZR07
Younhee Ko, Chengxiang Zhai, Sandra L. Rodriguez-Zas:
Inference of Gene Pathways Using Gaussian Mixture Models. BIBM 2007: 362-367
[c79]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/JiangZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/JiangZ07
Jing Jiang, ChengXiang Zhai:
A two-stage approach to domain adaptation for statistical classifiers. CIKM 2007: 401-410
[c78]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WangFZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WangFZ07
Xuanhui Wang, Hui Fang, ChengXiang Zhai:
Improve retrieval accuracy for difficult queries using negative feedback. CIKM 2007: 991-994
[c77]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/FangZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/FangZ07
Hui Fang, ChengXiang Zhai:
Probabilistic Models for Expert Finding. ECIR 2007: 418-430
[c76]
- view
  authority control:
- export record
  dblp key:
  - conf/icde/ChuangCZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icde/ChuangCZ07
Shui-Lung Chuang, Kevin Chen-Chuan Chang, ChengXiang Zhai:
Collaborative Wrapping: A Turbo Framework for Web Data Extraction. ICDE 2007: 1261-1262
[c75]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/MeiSZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/MeiSZ07
Qiaozhu Mei, Xuehua Shen, ChengXiang Zhai:
Automatic labeling of multinomial topic models. KDD 2007: 490-499
[c74]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/WangZHS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/WangZHS07
Xuanhui Wang, ChengXiang Zhai, Xiao Hu, Richard Sproat:
Mining correlated bursty topic patterns from coordinated text streams. KDD 2007: 784-793
[c73]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/naacl/Zhai07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Zhai07
ChengXiang Zhai:
Statistical Language Models for Information Retrieval. HLT-NAACL (Tutorial Abstracts) 2007: 3-4
[c72]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/naacl/JiangZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/JiangZ07
Jing Jiang, ChengXiang Zhai:
A Systematic Exploration of the Feature Space for Relation Extraction. HLT-NAACL 2007: 113-120
[c71]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/WangZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/WangZ07
Xuanhui Wang, ChengXiang Zhai:
Learn from web search logs to organize search results. SIGIR 2007: 87-94
[c70]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TanVFZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TanVFZ07
Bin Tan, Atulya Velivelli, Hui Fang, ChengXiang Zhai:
Term feedback for information retrieval with language models. SIGIR 2007: 263-270
[c69]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TaoZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TaoZ07
Tao Tao, ChengXiang Zhai:
An exploration of proximity measures in information retrieval. SIGIR 2007: 295-302
[c68]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/MeiFZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/MeiFZ07
Qiaozhu Mei, Hui Fang, ChengXiang Zhai:
A study of Poisson query generation model for information retrieval. SIGIR 2007: 319-326
[c67]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/LuJLHZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/LuJLHZ07
Yue Lu, Jing Jiang, Xu Ling, Xin He, ChengXiang Zhai:
Language Models for Genomics Information Retrieval: UIUC at TREC 2007 Genomics Track. TREC 2007
[c66]
- view
  - electronic edition @ vldb.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/vldb/ChuangCZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/vldb/ChuangCZ07
Shui-Lung Chuang, Kevin Chen-Chuan Chang, ChengXiang Zhai:
Context-Aware Wrapping: Synchronized Data Extraction. VLDB 2007: 699-710
[c65]
- view
  authority control:
- export record
  dblp key:
  - conf/www/MeiLWSZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/MeiLWSZ07
Qiaozhu Mei, Xu Ling, Matthew Wondra, Hang Su, ChengXiang Zhai:
Topic sentiment mixture: modeling facets and opinions in weblogs. WWW 2007: 171-180
[e2]
- view
- export record
  dblp key:
  - conf/naacl/2007
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/2007
Candace L. Sidner, Tanja Schultz, Matthew Stone, ChengXiang Zhai:
Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, April 22-27, 2007, Rochester, New York, USA. The Association for Computational Linguistics 2007 [contents]
2006
[j11]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/ZhaiL06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/ZhaiL06
ChengXiang Zhai, John D. Lafferty:
A risk minimization framework for information retrieval. Inf. Process. Manag. 42(1): 31-55 (2006)
[j10]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/JinSZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/JinSZ06
Rong Jin, Luo Si, Chengxiang Zhai:
A study of mixture models for collaborative filtering. Inf. Retr. 9(3): 357-382 (2006)
[j9]
- view
  authority control:
- export record
  dblp key:
  - journals/jamia/LuZVZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jamia/LuZVZ06
Xinghua Lu, Bin Zheng, Atulya Velivelli, ChengXiang Zhai:
Research Paper: Enhancing Text Categorization with Semantic-enriched Representation and Training Data Augmentation. J. Am. Medical Informatics Assoc. 13(5): 526-535 (2006)
[j8]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/JiangZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/JiangZ06
Jing Jiang, Chengxiang Zhai:
Extraction of coherent relevant passages using hidden Markov models. ACM Trans. Inf. Syst. 24(3): 295-319 (2006)
[c64]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/SproatTZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/SproatTZ06
Richard Sproat, Tao Tao, ChengXiang Zhai:
Named Entity Transliteration with Comparable Corpora. ACL 2006
[c63]
- view
  authority control:
- export record
  dblp key:
  - conf/asplos/LiTWLZZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asplos/LiTWLZZ06
Zhenmin Li, Lin Tan, Xuanhui Wang, Shan Lu, Yuanyuan Zhou, Chengxiang Zhai:
Have things changed now?: an empirical study of bug characteristics in modern open source software. ASID 2006: 25-33
[c62]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ShakeryZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ShakeryZ06
Azadeh Shakery, ChengXiang Zhai:
A probabilistic relevance propagation model for hypertext retrieval. CIKM 2006: 550-558
[c61]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/TaoZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/TaoZ06
Tao Tao, ChengXiang Zhai:
Best-k queries on database systems. CIKM 2006: 790-791
[c60]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/emnlp/TaoYFSZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/TaoYFSZ06
Tao Tao, Su-Youn Yoon, Andrew Fister, Richard Sproat, ChengXiang Zhai:
Unsupervised Named Entity Transliteration Using Temporal and Phonetic Correlation. EMNLP 2006: 250-257
[c59]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/MeiXCHZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/MeiXCHZ06
Qiaozhu Mei, Dong Xin, Hong Cheng, Jiawei Han, ChengXiang Zhai:
Generating semantic annotations for frequent patterns with context analysis. KDD 2006: 337-346
[c58]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/MeiZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/MeiZ06
Qiaozhu Mei, ChengXiang Zhai:
A mixture model for contextual text mining. KDD 2006: 649-655
[c57]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/TanSZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/TanSZ06
Bin Tan, Xuehua Shen, ChengXiang Zhai:
Mining long-term search history to improve search accuracy. KDD 2006: 718-723
[c56]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/naacl/JiangZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/JiangZ06
Jing Jiang, ChengXiang Zhai:
Exploiting Domain Structure for Named Entity Recognition. HLT-NAACL 2006
[c55]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/naacl/TaoWMZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/TaoWMZ06
Tao Tao, Xuanhui Wang, Qiaozhu Mei, ChengXiang Zhai:
Language Model Information Retrieval with Document Expansion. HLT-NAACL 2006
[c54]
- view
  - electronic edition @ stanford.edu (open access)
  - details & citations
- export record
  dblp key:
  - conf/psb/LingJHMZS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/psb/LingJHMZS06
Xu Ling, Jing Jiang, Xin He, Qiaozhu Mei, ChengXiang Zhai, Bruce R. Schatz:
Automatically Generating Gene Summaries from Biomedical Literature. Pacific Symposium on Biocomputing 2006: 40-51
[c53]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FangZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FangZ06
Hui Fang, ChengXiang Zhai:
Semantic term matching in axiomatic approaches to information retrieval. SIGIR 2006: 115-122
[c52]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TaoZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TaoZ06
Tao Tao, ChengXiang Zhai:
Regularized estimation of mixture models for robust pseudo-relevance feedback. SIGIR 2006: 162-169
[c51]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/WangSCZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/WangSCZ06
Xuanhui Wang, Jian-Tao Sun, Zheng Chen, ChengXiang Zhai:
Latent semantic analysis for multiple-type interrelated data objects. SIGIR 2006: 236-243
[c50]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/FangZZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/FangZZ06
Hui Fang, Lixin Zhou, ChengXiang Zhai:
Language Models for Expert Finding--UIUC TREC 2006 Enterprise Track Experiments. TREC 2006
[c49]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/JiangHZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/JiangHZ06
Jing Jiang, Xin He, ChengXiang Zhai:
Robust Pseudo Feedback Estimation and HMM Passage Extraction: UIUC at TREC 2006 Genomics Track. TREC 2006
[c48]
- view
  authority control:
- export record
  dblp key:
  - conf/www/MeiLSZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/MeiLSZ06
Qiaozhu Mei, Chao Liu, Hang Su, ChengXiang Zhai:
A probabilistic approach to spatiotemporal theme pattern mining on weblogs. WWW 2006: 533-542
2005
[c47]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/TaoWMZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/TaoWMZ05
Tao Tao, Xuanhui Wang, Qiaozhu Mei, ChengXiang Zhai:
Accurate language model estimation with document expansion. CIKM 2005: 273-274
[c46]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/JiangZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/JiangZ05
Jing Jiang, ChengXiang Zhai:
Accurately extracting coherent relevant passages using hidden Markov models. CIKM 2005: 289-290
[c45]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ShenTZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ShenTZ05
Xuehua Shen, Bin Tan, ChengXiang Zhai:
Implicit user modeling for personalized search. CIKM 2005: 824-831
[c44]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/MeiZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/MeiZ05
Qiaozhu Mei, ChengXiang Zhai:
Discovering evolutionary theme patterns from text: an exploration of temporal text mining. KDD 2005: 198-207
[c43]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/TaoZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/TaoZ05
Tao Tao, ChengXiang Zhai:
Mining comparable bilingual text corpora for cross-language information integration. KDD 2005: 691-696
[c42]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShenTZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShenTZ05
Xuehua Shen, Bin Tan, ChengXiang Zhai:
Context-sensitive information retrieval using implicit feedback. SIGIR 2005: 43-50
[c41]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShenZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShenZ05
Xuehua Shen, ChengXiang Zhai:
Active feedback in ad hoc information retrieval. SIGIR 2005: 59-66
[c40]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FangZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FangZ05
Hui Fang, ChengXiang Zhai:
An exploration of axiomatic approaches to information retrieval. SIGIR 2005: 480-487
[c39]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShenTZ05a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShenTZ05a
Xuehua Shen, Bin Tan, ChengXiang Zhai:
UCAIR: a personalized search toolbar. SIGIR 2005: 681
[c38]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/FangZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/FangZ05
Hui Fang, ChengXiang Zhai:
An Axiomatic Approach to IR--UIUC TREC 2005 Robust Track Experiments. TREC 2005
[c37]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/TanVFZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/TanVFZ05
Bin Tan, Atulya Velivelli, Hui Fang, ChengXiang Zhai:
Interactive Construction of Query Language Models - UIUC TREC 2005 HARD Track Experiments. TREC 2005
[c36]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/ZhaiLHVWFSL05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/ZhaiLHVWFSL05
ChengXiang Zhai, Xu Ling, Xin He, Atulya Velivelli, Xuanhui Wang, Hui Fang, Azadeh Shakery, Xinghua Lu:
UIUC/MUSC at TREC 2005 Genomics Track. TREC 2005
2004
[j7]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/bmcbi/LuZGB04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bmcbi/LuZGB04
Xinghua Lu, Chengxiang Zhai, Vanathi Gopalakrishnan, Bruce G. Buchanan:
Automatic annotation of protein motif function with Gene Ontology terms. BMC Bioinform. 5: 122 (2004)
[j6]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/ZhaiL04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/ZhaiL04
ChengXiang Zhai, John D. Lafferty:
A study of smoothing methods for language models applied to information retrieval. ACM Trans. Inf. Syst. 22(2): 179-214 (2004)
[c35]
- view
  authority control:
- export record
  dblp key:
  - conf/csb/FangZLY04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/csb/FangZLY04
Hui Fang, ChengXiang Zhai, Lei Liu, Jiong Yang:
Subspace Clustering for Microarray Data Analysis: Multiple Criteria and Significance Assessment. CSB 2004: 582-583
[c34]
- view
  authority control:
- export record
  dblp key:
  - conf/icmcs/VelivelliZH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icmcs/VelivelliZH04
Atulya Velivelli, ChengXiang Zhai, Thomas S. Huang:
Audio segment retrieval using a short duration example query. ICME 2004: 1603-1606
[c33]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/ZhaiVY04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/ZhaiVY04
ChengXiang Zhai, Atulya Velivelli, Bei Yu:
A cross-collection mixture model for comparative text mining. KDD 2004: 743-748
[c32]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FangTZ04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FangTZ04
Hui Fang, Tao Tao, ChengXiang Zhai:
A formal study of information retrieval heuristics. SIGIR 2004: 49-56
[c31]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TaoZ04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TaoZ04
Tao Tao, ChengXiang Zhai:
A two-stage mixture model for pseudo feedback. SIGIR 2004: 486-487
[c30]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SriramSZ04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SriramSZ04
Smitha Sriram, Xuehua Shen, ChengXiang Zhai:
A session-based search engine. SIGIR 2004: 492-493
[c29]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShenSZ04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShenSZ04
Xuehua Shen, Smitha Sriram, ChengXiang Zhai:
ACES: a contextual engine for search. SIGIR 2004: 597
[c28]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/JiangZ04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/JiangZ04
Jing Jiang, ChengXiang Zhai:
UIUC in HARD 2004--Passage Retrieval Using HMMs. TREC 2004
[e1]
- view
  - table of contents in dblp
  - details & citations
- export record
  dblp key:
  - conf/cikm/2004
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/2004
David A. Grossman, Luis Gravano, ChengXiang Zhai, Otthein Herzog, David A. Evans:
Proceedings of the 2004 ACM CIKM International Conference on Information and Knowledge Management, Washington, DC, USA, November 8-13, 2004. ACM 2004, ISBN 1-58113-874-1 [contents]
2003
[j5]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
James Allan, Jay Aslam, Nicholas J. Belkin, Chris Buckley, James P. Callan, W. Bruce Croft, Susan T. Dumais, Norbert Fuhr, Donna Harman, David J. Harper, Djoerd Hiemstra, Thomas Hofmann, Eduard H. Hovy, Wessel Kraaij, John D. Lafferty, Victor Lavrenko, David D. Lewis, Liz Liddy, R. Manmatha, Andrew McCallum, Jay M. Ponte, John M. Prager, Dragomir R. Radev, Philip Resnik, Stephen E. Robertson, Ronald Rosenfeld, Salim Roukos, Mark Sanderson, Richard M. Schwartz, Amit Singhal, Alan F. Smeaton, Howard R. Turtle, Ellen M. Voorhees, Ralph M. Weischedel, Jinxi Xu, ChengXiang Zhai:
Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002. SIGIR Forum 37(1): 31-47 (2003)
[c27]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/YuZH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/YuZH03
Hwanjo Yu, ChengXiang Zhai, Jiawei Han:
Text classification from positive and unlabeled documents. CIKM 2003: 232-239
[c26]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/JinSZC03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/JinSZC03
Rong Jin, Luo Si, ChengXiang Zhai, James P. Callan:
Collaborative filtering with decoupled models for preferences and ratings. CIKM 2003: 309-316
[c25]
- view
  authority control:
- export record
  dblp key:
  - conf/drr/JinZH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/drr/JinZH03
Rong Jin, ChengXiang Zhai, Alexander G. Hauptmann:
Information retrieval for OCR documents: a content-based probabilistic correction model. DRR 2003: 128-135
[c24]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhaiCL03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhaiCL03
ChengXiang Zhai, William W. Cohen, John D. Lafferty:
Beyond independent relevance: methods and evaluation metrics for subtopic retrieval. SIGIR 2003: 10-17
[c23]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShenZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShenZ03
Xuehua Shen, ChengXiang Zhai:
Exploiting query history for document ranking in interactive information retrieval. SIGIR 2003: 377-378
[c22]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/HuBZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/HuBZ03
Xiao Hu, Sindhura Bandhakavi, ChengXiang Zhai:
Error analysis of difficult TREC topics. SIGIR 2003: 407-408
[c21]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/ShenZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/ShenZ03
Xuehua Shen, ChengXiang Zhai:
Active Feedback - UIUC TREC-2003 HARD Experiments. TREC 2003: 662-666
[c20]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/ZhaiTFS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/ZhaiTFS03
ChengXiang Zhai, Tao Tao, Hui Fang, Zhidi Shang:
Improving the Robustness of Language Models - UIUC TREC 2003 Robust and Genomics Experiments. TREC 2003: 667-672
[c19]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/ShakeryZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/ShakeryZ03
Azadeh Shakery, ChengXiang Zhai:
Relevance Propagation for Topic Distillation UIUC TREC 2003 Web Track Experiments. TREC 2003: 673-677
[c18]
- view
- export record
  dblp key:
  - conf/uai/JinSZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/uai/JinSZ03
Rong Jin, Luo Si, ChengXiang Zhai:
Preference-based Graphic Models for Collaborative Filtering. UAI 2003: 329-336
[c17]
- view
  - electronic edition @ ogi.edu
  - details & citations
- export record
  dblp key:
  - conf/webdb/McCannDVKZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/webdb/McCannDVKZ03
Robert McCann, AnHai Doan, Vanitha Varadarajan, Alexander Kramnik, ChengXiang Zhai:
Building Data Integration Systems: A Mass Collaboration Approach. WebDB 2003: 25-30
2002
[j4]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/Zhai02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/Zhai02
ChengXiang Zhai:
Risk minimization and language modeling in text retrieval dissertation abstract. SIGIR Forum 36(2): 100-101 (2002)
[j3]
- view
  authority control:
- export record
  dblp key:
  - journals/sigmod/WinslettCDHZZ02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigmod/WinslettCDHZZ02
Marianne Winslett, Kevin Chen-Chuan Chang, AnHai Doan, Jiawei Han, ChengXiang Zhai, Yuanyuan Zhou:
Database Research at the University of Illinois at Urbana-Champaign. SIGMOD Rec. 31(3): 97-102 (2002)
[c16]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JinHZ02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JinHZ02
Rong Jin, Alexander G. Hauptmann, ChengXiang Zhai:
Title language model for information retrieval. SIGIR 2002: 42-48
[c15]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhaiL02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhaiL02
ChengXiang Zhai, John D. Lafferty:
Two-stage language models for information retrieval. SIGIR 2002: 49-56
2001
[c14]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ZhaiL01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ZhaiL01
ChengXiang Zhai, John D. Lafferty:
Model-based Feedback in the Language Modeling Approach to Information Retrieval. CIKM 2001: 403-410
[c13]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LaffertyZ01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LaffertyZ01
John D. Lafferty, ChengXiang Zhai:
Document Language Models, Query Models, and Risk Minimization for Information Retrieval. SIGIR 2001: 111-119
[c12]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhaiL01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhaiL01
ChengXiang Zhai, John D. Lafferty:
A Study of Smoothing Methods for Language Models Applied to Ad Hoc Information Retrieval. SIGIR 2001: 334-342
2000
[c11]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhaiJE00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhaiJE00
ChengXiang Zhai, Peter Jansen, David A. Evans:
Exploration of a heuristic approach to threshold learning in adaptive filtering. SIGIR 2000: 360-362

1990 – 1999

see FAQ

What is the meaning of the colors in the publication lists?

1999
[c10]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/EvansBTHZS99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/EvansBTHZS99
David A. Evans, Jeffrey Bennett, Xiang Tong, Alison Huettner, ChengXiang Zhai, Emilia Stoica:
CLARIT TREC-8 Manual Ad-Hoc Experiments. TREC 1999
[c9]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/ZhaiJRSE99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/ZhaiJRSE99
ChengXiang Zhai, Peter Jansen, Norbert Roma, Emilia Stoica, David A. Evans:
Optimization in CLARIT TREC-8 Adaptive Filtering. TREC 1999
1998
[c8]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/trec/ZhaiJSGE98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/ZhaiJSGE98
ChengXiang Zhai, Peter Jansen, Emilia Stoica, Norbert Grot, David A. Evans:
Threshold Calibration in CLARIT Adaptive Filtering. TREC 1998: 96-103
1997
[c7]
- view
  authority control:
- export record
  dblp key:
  - conf/anlp/Zhai97
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/anlp/Zhai97
ChengXiang Zhai:
Fast Statistical Parsing of Noun Phrases for Document Indexing. ANLP 1997: 312-319
[i3]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/cmp-lg-9701001
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/cmp-lg-9701001
ChengXiang Zhai:
Exploiting Context to Identify Lexical Atoms - A Statistical View of Linguistic Context. CoRR cmp-lg/9701001 (1997)
[i2]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/cmp-lg-9702009
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/cmp-lg-9702009
ChengXiang Zhai:
Fast Statistical Parsing of Noun Phrases for Document Indexing. CoRR cmp-lg/9702009 (1997)
1996
[c6]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/EvansZ96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/EvansZ96
David A. Evans, ChengXiang Zhai:
Noun-Phrase Analysis in Unrestricted Text for Information Retrieval. ACL 1996: 17-24
[c5]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/trec/Milic-FraylingETZ96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Milic-FraylingETZ96
Natasa Milic-Frayling, David A. Evans, Xiang Tong, ChengXiang Zhai:
CLARIT Compound Queries and Constraint-Controlled Feedback in TREC-5 Ad-Hoc Experiments. TREC 1996
[c4]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/TongZME96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/TongZME96
Xiang Tong, ChengXiang Zhai, Natasa Milic-Frayling, David A. Evans:
Experiments on Chinese Text Indexing -- CLARIT TREC-5 Chinese Track Report. TREC 1996
[c3]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/TongZME96a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/TongZME96a
Xiang Tong, ChengXiang Zhai, Natasa Milic-Frayling, David A. Evans:
OCR Correction and Query Expansion for Retrieval on OCR Data -- CLARIT TREC-5 Confusion Track Report. TREC 1996
[c2]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/TongZME96b
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/TongZME96b
Xiang Tong, ChengXiang Zhai, Natasa Milic-Frayling, David A. Evans:
Evaluation of Syntactic Phrase Indexing -- CLARIT NLP Track Report. TREC 1996
[i1]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/cmp-lg-9605019
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/cmp-lg-9605019
David A. Evans, ChengXiang Zhai:
Noun-Phrase Analysis in Unrestricted Text for Information Retrieval. CoRR cmp-lg/9605019 (1996)
1995
[c1]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/trec/Milic-FraylingMELZT95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Milic-FraylingMELZT95
Natasa Milic-Frayling, Michael P. Mastroianni, David A. Evans, Robert G. Lefferts, ChengXiang Zhai, Xiang Tong:
CLARIT TREC-4 Interactive Experiments. TREC 1995
1990
[j2]
- view
  authority control:
- export record
  dblp key:
  - journals/sigplan/Zhai90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigplan/Zhai90
ChengXiang Zhai:
Preliminary ideas of a conceptual programming language. ACM SIGPLAN Notices 25(12): 93-100 (1990)

1980 – 1989

see FAQ

What is the meaning of the colors in the publication lists?

1988
[j1]
- view
  authority control:
- export record
  dblp key:
  - journals/sigsoft/ZhengZ88
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigsoft/ZhengZ88
Guoliang Zheng, Chengxiang Zhai:
The kernel of Modula-2 integrated environment. ACM SIGSOFT Softw. Eng. Notes 13(4): 57-60 (1988)

Coauthor Index

see FAQ

manage site settings

To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.