default search action

combined dblp search
author search
venue search
publication search

ask others

Mark Sanderson

> Home > Persons

Person information

affiliation: RMIT University, Melbourne, Australia
affiliation (former): University of Sheffield, England, UK
affiliation (PhD 1996): University of Glasgow, UK

Refine list

refinements active!

zoomed in on ?? of ?? records

view refined list in

export refined list as

showing all ?? records

2020 – today

see FAQ

What is the meaning of the colors in the publication lists?

2025
[j85]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/ijmms/XuanSSHS25
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijmms/XuanSSHS25
Yueqing Xuan, Edward Small, Kacper Sokol, Danula Hettiachchi, Mark Sanderson:
Comprehension is a double-edged sword: Over-interpreting unspecified information in intelligible machine learning explanations. Int. J. Hum. Comput. Stud. 193: 103376 (2025)
2024
[j84]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/jasis/JahaniAS24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/JahaniAS24
Hamed Jahani, Leif Azzopardi, Mark Sanderson:
Measuring the retrievability of digital library content using analytics data. J. Assoc. Inf. Sci. Technol. 75(11): 1233-1248 (2024)
[c192]
- view
  authority control:
- export record
  dblp key:
  - conf/aughuman2/KegalleHCSS24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aughuman2/KegalleHCSS24
Hiruni Kegalle, Danula Hettiachchi, Jeffrey Chan, Flora D. Salim, Mark Sanderson:
E-Scooter Dynamics: Unveiling Rider Behaviours and Interactions with Road Users through Multi-Modal Data Analysis. AHs 2024: 307-310
[c191]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/0001S24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/0001S24
Nicola Ferro, Mark Sanderson:
Uncontextualized significance considered dangerous. SIGIR 2024: 261-270
[c190]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir-ap/Alaofi0SS24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir-ap/Alaofi0SS24
Marwah Alaofi, Paul Thomas, Falk Scholer, Mark Sanderson:
LLMs can be Fooled into Labelling a Document as Relevant: best café near me; this paper is perfectly relevant. SIGIR-AP 2024: 32-41
[c189]
- view
  authority control:
- export record
  dblp key:
  - conf/www/MaRCS24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/MaRCS24
Chenglong Ma, Yongli Ren, Pablo Castells, Mark Sanderson:
Temporal Conformity-aware Hawkes Graph Network for Recommendations. WWW 2024: 3185-3194
[i21]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2403-09180
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2403-09180
Leila Tavakoli, Johanne R. Trippas, Hamed Zamani, Falk Scholer, Mark Sanderson:
Online and Offline Evaluation in Search Clarification. CoRR abs/2403.09180 (2024)
[i20]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2404-08137
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2404-08137
Marwah Alaofi, Negar Arabzadeh, Charles L. A. Clarke, Mark Sanderson:
Generative Information Retrieval Evaluation. CoRR abs/2404.08137 (2024)
[i19]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2410-02273
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2410-02273
Yueqing Xuan, Kacper Sokol, Mark Sanderson, Jeffrey Chan:
Perfect Counterfactuals in Imperfect Worlds: Modelling Noisy Implementation of Actions in Sequential Algorithmic Recourse. CoRR abs/2410.02273 (2024)
[i18]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2410-15272
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2410-15272
Jiayang Niu, Jie Li, Ke Deng, Mark Sanderson, Yongli Ren:
Performance-Driven QUBO for Recommender Systems on Quantum Annealers. CoRR abs/2410.15272 (2024)
2023
[j83]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/SpinaSADMSW23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/SpinaSADMSW23
Damiano Spina, Mark Sanderson, Daniel Angus, Gianluca Demartini, Dana McKay, Lauren L. Saling, Ryen W. White:
Human-AI Cooperation to Tackle Misinformation and Polarization. Commun. ACM 66(7): 40-45 (2023)
[j82]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/datamine/TrisedyaSCSSS23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/datamine/TrisedyaSCSSS23
Bayu Distiawan Trisedya, Flora D. Salim, Jeffrey Chan, Damiano Spina, Falk Scholer, Mark Sanderson:
i-Align: an interpretable knowledge graph alignment model. Data Min. Knowl. Discov. 37(6): 2494-2516 (2023)
[j81]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/SandersonLHGS23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/SandersonLHGS23
Mark Sanderson, Ramon Lobato, Kieran Hegarty, Lisa M. Given, Chirag Shah:
Report on The Web Search Revolution: Symposium. SIGIR Forum 57(2): 14:1-14:10 (2023)
[c188]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/Bolotova-Baranova23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/Bolotova-Baranova23
Valeria Bolotova-Baranova, Vladislav Blinov, Sofya Filippova, Falk Scholer, Mark Sanderson:
WikiHowQA: A Comprehensive Benchmark for Multi-Document Non-Factoid Question Answering. ACL (1) 2023: 5291-5314
[c187]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/HettiachchiJKMS23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/HettiachchiJKMS23
Danula Hettiachchi, Kaixin Ji, Jenny Kennedy, Anthony McCosker, Flora D. Salim, Mark Sanderson, Falk Scholer, Damiano Spina:
Designing and Evaluating Presentation Strategies for Fact-Checked Content. CIKM 2023: 751-761
[c186]
- view
  authority control:
- export record
  dblp key:
  - conf/mdm/KegalleHCSS23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mdm/KegalleHCSS23
Hiruni Kegalle, Danula Hettiachchi, Jeffrey Chan, Flora D. Salim, Mark Sanderson:
Are footpaths encroached by shared e-scooters? Spatio-temporal Analysis of Micro-mobility Services. MDM 2023: 255-264
[c185]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/AlaofiGSS023
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/AlaofiGSS023
Marwah Alaofi, Luke Gallagher, Mark Sanderson, Falk Scholer, Paul Thomas:
Can Generative LLMs Create Query Variants for Test Collections? An Exploratory Study. SIGIR 2023: 1869-1873
[i17]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2304-07487
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2304-07487
Yueqing Xuan, Kacper Sokol, Jeffrey Chan, Mark Sanderson:
More Is Less: When Do Recommenders Underperform for Data-rich Users? CoRR abs/2304.07487 (2023)
[i16]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2304-08721
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2304-08721
Hiruni Kegalle, Danula Hettiachchi, Jeffrey Chan, Flora D. Salim, Mark Sanderson:
Are footpaths encroached by shared e-scooters? Spatio-temporal Analysis of Micro-mobility Services. CoRR abs/2304.08721 (2023)
[i15]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2308-10220
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2308-10220
Danula Hettiachchi, Kaixin Ji, Jenny Kennedy, Anthony McCosker, Flora Dylis Salim, Mark Sanderson, Falk Scholer, Damiano Spina:
Designing and Evaluating Presentation Strategies for Fact-Checked Content. CoRR abs/2308.10220 (2023)
[i14]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2308-13755
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2308-13755
Bayu Distiawan Trisedya, Flora D. Salim, Jeffrey Chan, Damiano Spina, Falk Scholer, Mark Sanderson:
i-Align: an interpretable knowledge graph alignment model. CoRR abs/2308.13755 (2023)
[i13]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2309-01288
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2309-01288
Danula Hettiachchi, Indigo Holcombe-James, Stephanie Livingstone, Anjalee de Silva, Matthew Lease, Flora D. Salim, Mark Sanderson:
How Crowd Worker Factors Influence Subjective Annotations: A Study of Tagging Misogynistic Hate Speech in Tweets. CoRR abs/2309.01288 (2023)
[i12]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2309-08438
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2309-08438
Yueqing Xuan, Edward Small, Kacper Sokol, Danula Hettiachchi, Mark Sanderson:
Can Users Correctly Interpret Machine Learning Explanations and Simultaneously Identify Their Limitations? CoRR abs/2309.08438 (2023)
2022
[j80]
- view
  authority control:
- export record
  dblp key:
  - journals/ijmms/KhaokaewHRLTSBB22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijmms/KhaokaewHRLTSBB22
Yonchanok Khaokaew, Indigo Holcombe-James, Mohammad Saiedur Rahaman, Jonathan Liono, Johanne R. Trippas, Damiano Spina, Peter Bailey, Nicholas J. Belkin, Paul N. Bennett, Yongli Ren, Mark Sanderson, Falk Scholer, Ryen W. White, Flora D. Salim:
Imagining future digital assistants at work: A study of task management needs. Int. J. Hum. Comput. Stud. 168: 102905 (2022)
[j79]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/TavakoliZSCS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/TavakoliZSCS22
Leila Tavakoli, Hamed Zamani, Falk Scholer, William Bruce Croft, Mark Sanderson:
Analyzing clarification in asynchronous information-seeking conversations. J. Assoc. Inf. Sci. Technol. 73(3): 449-471 (2022)
[j78]
- view
  authority control:
- export record
  dblp key:
  - journals/percom/KangRRSWS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/percom/KangRRSWS22
Yufan Kang, Mohammad Saiedur Rahaman, Yongli Ren, Mark Sanderson, Ryen W. White, Flora D. Salim:
App usage on-the-move: Context- and commute-aware next app prediction. Pervasive Mob. Comput. 87: 101704 (2022)
[c184]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/MaRCS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/MaRCS22
Chenglong Ma, Yongli Ren, Pablo Castells, Mark Sanderson:
NEST: Simulating Pandemic-like Events for Collaborative Filtering by Modeling User Needs Evolution. CIKM 2022: 1430-1440
[c183]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/BolotovaBSCS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/BolotovaBSCS22
Valeria Bolotova, Vladislav Blinov, Falk Scholer, W. Bruce Croft, Mark Sanderson:
A Non-Factoid Question-Answering Taxonomy. SIGIR 2022: 1196-1207
[c182]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/MaRCS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/MaRCS22
Chenglong Ma, Yongli Ren, Pablo Castells, Mark Sanderson:
Evaluation of Herd Behavior Caused by Population-scale Concept Drift in Collaborative Filtering. SIGIR 2022: 1984-1989
[c181]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/AlaofiGMSSSSW22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/AlaofiGMSSSSW22
Marwah Alaofi, Luke Gallagher, Dana McKay, Lauren L. Saling, Mark Sanderson, Falk Scholer, Damiano Spina, Ryen W. White:
Where Do Queries Come From? SIGIR 2022: 2850-2862
[c180]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TavakoliTZSS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TavakoliTZSS22
Leila Tavakoli, Johanne R. Trippas, Hamed Zamani, Falk Scholer, Mark Sanderson:
MIMICS-Duo: Offline & Online Evaluation of Search Clarification. SIGIR 2022: 3198-3208
[c179]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/0001S22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/0001S22
Nicola Ferro, Mark Sanderson:
How Do You Test a Test?: A Multifaceted Examination of Significance Tests. WSDM 2022: 280-288
[i11]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2206-04417
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2206-04417
Leila Tavakoli, Johanne R. Trippas, Hamed Zamani, Falk Scholer, Mark Sanderson:
MIMICS-Duo: Offline & Online Evaluation of Search Clarification. CoRR abs/2206.04417 (2022)
[i10]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2208-03443
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2208-03443
Yonchanok Khaokaew, Indigo Holcombe-James, Mohammad Saiedur Rahaman, Jonathan Liono, Johanne R. Trippas, Damiano Spina, Nicholas J. Belkin, Peter Bailey, Paul N. Bennett, Yongli Ren, Mark Sanderson, Falk Scholer, Ryen W. White, Flora D. Salim:
Imagining Future Digital Assistants at Work: A Study of Task Management Needs. CoRR abs/2208.03443 (2022)
2021
[j77]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/Mena-MaldonadoC21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/Mena-MaldonadoC21
Elisa Mena-Maldonado, Rocío Cañamares, Pablo Castells, Yongli Ren, Mark Sanderson:
Popularity Bias in False-positive Metrics for Recommender Systems Evaluation. ACM Trans. Inf. Syst. 39(3): 36:1-36:43 (2021)
[j76]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/HauffKSZZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/HauffKSZZ21
Claudia Hauff, Julia Kiseleva, Mark Sanderson, Hamed Zamani, Yongfeng Zhang:
Conversational Search and Recommendation: Introduction to the Special Issue. ACM Trans. Inf. Syst. 39(4): 38:1-38:6 (2021)
[c178]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/CambazogluBSSTC21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/CambazogluBSSTC21
Berkant Barla Cambazoglu, Valeria Bolotova-Baranova, Falk Scholer, Mark Sanderson, Leila Tavakoli, W. Bruce Croft:
Quantifying Human-Perceived Answer Utility in Non-factoid Question Answering. CHIIR 2021: 75-84
[c177]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/CambazogluTSSC21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/CambazogluTSSC21
Berkant Barla Cambazoglu, Leila Tavakoli, Falk Scholer, Mark Sanderson, W. Bruce Croft:
An Intent Taxonomy for Questions Asked in Web Search. CHIIR 2021: 85-94
[c176]
- view
  authority control:
- export record
  dblp key:
  - conf/cscw/HettiachchiS0HK21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cscw/HettiachchiS0HK21
Danula Hettiachchi, Mark Sanderson, Jorge Gonçalves, Simo Hosio, Gabriella Kazai, Matthew Lease, Mike Schaekermann, Emine Yilmaz:
Investigating and Mitigating Biases in Crowdsourced Data. CSCW Companion 2021: 331-334
[c175]
- view
  authority control:
- export record
  dblp key:
  - conf/cui/TrippasSSC21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cui/TrippasSSC21
Johanne R. Trippas, Damiano Spina, Mark Sanderson, Lawrence Cavedon:
Accessing Media Via an Audio-only Communication Channel: A Log Analysis. CUI 2021: 28:1-28:6
[i9]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2111-14322
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2111-14322
Danula Hettiachchi, Mark Sanderson, Jorge Gonçalves, Simo Hosio, Gabriella Kazai, Matthew Lease, Mike Schaekermann, Emine Yilmaz:
Proceedings of the CSCW 2021 Workshop - Investigating and Mitigating Biases in Crowdsourced Data. CoRR abs/2111.14322 (2021)
2020
[j75]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/TrippasSTSJC20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/TrippasSTSJC20
Johanne R. Trippas, Damiano Spina, Paul Thomas, Mark Sanderson, Hideo Joho, Lawrence Cavedon:
Towards a model for spoken conversational search. Inf. Process. Manag. 57(2): 102162 (2020)
[j74]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/RoiteroCSSM20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/RoiteroCSSM20
Kevin Roitero, J. Shane Culpepper, Mark Sanderson, Falk Scholer, Stefano Mizzaro:
Fewer topics? A million topics? Both?! On topics subsets in test collections. Inf. Retr. J. 23(1): 49-85 (2020)
[j73]
- view
  authority control:
- export record
  dblp key:
  - journals/isci/LiSCS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/isci/LiSCS20
Pengfei Li, Mark Sanderson, Mark J. Carman, Falk Scholer:
Self-labeling methods for unsupervised transfer ranking. Inf. Sci. 516: 293-315 (2020)
[j72]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AnandCHJSS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AnandCHJSS20
Avishek Anand, Lawrence Cavedon, Matthias Hagen, Hideo Joho, Mark Sanderson, Benno Stein:
Dagstuhl seminar 19461 on conversational search: seminar goals and working group outcomes. SIGIR Forum 54(1): 3:1-3:11 (2020)
[j71]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CambazogluSSC20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CambazogluSSC20
Berkant Barla Cambazoglu, Mark Sanderson, Falk Scholer, W. Bruce Croft:
A review of public datasets in question answering research. SIGIR Forum 54(2): 5:1-5:23 (2020)
[j70]
- view
  authority control:
- export record
  dblp key:
  - journals/tosn/KaurSRCTS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tosn/KaurSRCTS20
Manpreet Kaur, Flora D. Salim, Yongli Ren, Jeffrey Chan, Martin Tomko, Mark Sanderson:
Joint Modelling of Cyber Activities and Physical Context to Improve Prediction of Visitor Behaviors. ACM Trans. Sens. Networks 16(3): 28:1-28:25 (2020)
[j69]
- view
  authority control:
- export record
  dblp key:
  - journals/www/YuanBST20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/www/YuanBST20
Chengzhe Yuan, Zhifeng Bao, Mark Sanderson, Yong Tang:
Incorporating word attention with convolutional neural networks for abstractive summarization. World Wide Web 23(1): 267-287 (2020)
[c174]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/AlanaziSBK20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/AlanaziSBK20
Afrah Olayan Alanazi, Mark Sanderson, Zhifeng Bao, Jaewon Kim:
The Impact of Ad Quality and Position on Mobile SERPs. CHIIR 2020: 318-322
[c173]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/BolotovaBZCSS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/BolotovaBZCSS20
Valeria Bolotova, Vladislav Blinov, Yukun Zheng, W. Bruce Croft, Falk Scholer, Mark Sanderson:
Do People and Neural Nets Pay Attention to the Same Words: Studying Eye-tracking Data for Non-factoid QA Evaluation. CIKM 2020: 85-94
[c172]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/0002SCCS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/0002SCCS20
Zhijing Wu, Mark Sanderson, Berkant Barla Cambazoglu, W. Bruce Croft, Falk Scholer:
Providing Direct Answers in Search Results: A Study of User Behavior. CIKM 2020: 1635-1644
[c171]
- view
  authority control:
- export record
  dblp key:
  - conf/ictir/Sanderson20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ictir/Sanderson20
Mark Sanderson:
Modeling Search Engine Performance Measurement. ICTIR 2020: 1
[c170]
- view
  authority control:
- export record
  dblp key:
  - conf/mir/LionoRSRSSTSBW20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mir/LionoRSRSSTSBW20
Jonathan Liono, Mohammad Saiedur Rahaman, Flora D. Salim, Yongli Ren, Damiano Spina, Falk Scholer, Johanne R. Trippas, Mark Sanderson, Paul N. Bennett, Ryen W. White:
Intelligent Task Recognition: Towards Enabling Productivity Assistance in Daily Life. ICMR 2020: 472-478
[c169]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Mena-MaldonadoC20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Mena-MaldonadoC20
Elisa Mena-Maldonado, Rocío Cañamares, Pablo Castells, Yongli Ren, Mark Sanderson:
Agreement and Disagreement between True and False-Positive Metrics in Recommender Systems Evaluation. SIGIR 2020: 841-850
[c168]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ScanlonZZS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ScanlonZZS20
Liam Scanlon, Shiwei Zhang, Xiuzhen Zhang, Mark Sanderson:
Evaluation of Cross Domain Text Summarization. SIGIR 2020: 1853-1856
[c167]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/ZhengMLSZM20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/ZhengMLSZM20
Yukun Zheng, Jiaxin Mao, Yiqun Liu, Mark Sanderson, Min Zhang, Shaoping Ma:
Investigating Examination Behavior in Mobile Search. WSDM 2020: 771-779
[i8]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2001-06910
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2001-06910
Krisztian Balog, Lucie Flekova, Matthias Hagen, Rosie Jones, Martin Potthast, Filip Radlinski, Mark Sanderson, Svitlana Vakulenko, Hamed Zamani:
Common Conversational Community Prototype: Scholarly Conversational Assistant. CoRR abs/2001.06910 (2020)
[i7]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2005-08658
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2005-08658
Avishek Anand, Lawrence Cavedon, Matthias Hagen, Hideo Joho, Mark Sanderson, Benno Stein:
Conversational Search - A Report from Dagstuhl Seminar 19461. CoRR abs/2005.08658 (2020)
[i6]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2008-11400
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2008-11400
Manpreet Kaur, Flora D. Salim, Yongli Ren, Jeffrey Chan, Martin Tomko, Mark Sanderson:
Joint Modelling of Cyber Activities and Physical Context to Improve Prediction of Visitor Behaviors. CoRR abs/2008.11400 (2020)

2010 – 2019

see FAQ

What is the meaning of the colors in the publication lists?

2019
[j68]
- view
  authority control:
- export record
  dblp key:
  - journals/oir/AladhadhZS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/oir/AladhadhZS19
Suliman Aladhadh, Xiuzhen Zhang, Mark Sanderson:
Location impact on source and linguistic features for information credibility of social media. Online Inf. Rev. 43(1): 89-112 (2019)
[j67]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/OlteanuGRERLBOL19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/OlteanuGRERLBOL19
Alexandra Olteanu, Jean Garcia-Gathright, Maarten de Rijke, Michael D. Ekstrand, Adam Roegiest, Aldo Lipani, Alex Beutel, Ana Lucic, Ana-Andreea Stoica, Anubrata Das, Asia Biega, Bart Voorn, Claudia Hauff, Damiano Spina, David D. Lewis, Douglas W. Oard, Emine Yilmaz, Faegheh Hasibi, Gabriella Kazai, Graham McDonald, Hinda Haned, Iadh Ounis, Ilse van der Linden, Joris Baan, Kamuela N. Lau, Krisztian Balog, Mahmoud F. Sayed, Maria Panteli, Mark Sanderson, Matthew Lease, Preethi Lahoti, Toshihiro Kamishima:
FACTS-IR: fairness, accountability, confidentiality, transparency, and safety in information retrieval. SIGIR Forum 53(2): 20-43 (2019)
[j66]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/FerroKS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/FerroKS19
Nicola Ferro, Yubin Kim, Mark Sanderson:
Using Collection Shards to Study Retrieval Performance Effect Sizes. ACM Trans. Inf. Syst. 37(3): 30:1-30:40 (2019)
[j65]
- view
  authority control:
- export record
  dblp key:
  - journals/tsoco/MouradSMS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tsoco/MouradSMS19
Ahmed Mourad, Falk Scholer, Walid Magdy, Mark Sanderson:
A Practical Guide for the Effective Evaluation of Twitter User Geolocation. ACM Trans. Soc. Comput. 2(3): 9:1-9:23 (2019)
[c166]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/TrippasSSABBWLR19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/TrippasSSABBWLR19
Johanne R. Trippas, Damiano Spina, Falk Scholer, Ahmed Hassan Awadallah, Peter Bailey, Paul N. Bennett, Ryen W. White, Jonathan Liono, Yongli Ren, Flora D. Salim, Mark Sanderson:
Learning About Work Tasks to Inform Intelligent Assistant Design. CHIIR 2019: 5-14
[c165]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/MaoSSSS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/MaoSSSS19
Jiaxin Mao, Damiano Spina, Sargol Sadeghi, Falk Scholer, Mark Sanderson:
Investigating the Learning Process in Job Search: A Longitudinal Study. CIKM 2019: 2461-2464
[c164]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/ecir/KimTSBC19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/KimTSBC19
Jaewon Kim, Johanne R. Trippas, Mark Sanderson, Zhifeng Bao, W. Bruce Croft:
How do Computer Scientists Use Google Scholar?: A Survey of User Interest in Elements on SERPs and Author Profile Pages. BIR@ECIR 2019: 64-75
[c163]
- view
  authority control:
- export record
  dblp key:
  - conf/icalp2/AlqahtaniS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icalp2/AlqahtaniS19
Fatimah Abdullah Alqahtani, Mark Sanderson:
Generating a Lexicon for the Hijazi Dialect in Arabic. ICALP 2019: 3-17
[c162]
- view
  authority control:
- export record
  dblp key:
  - conf/pkdd/AvineshRMCBS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/AvineshRMCBS19
P. V. S. Avinesh, Yongli Ren, Christian M. Meyer, Jeffrey Chan, Zhifeng Bao, Mark Sanderson:
J3R: Joint Multi-task Learning of Ratings and Review Summaries for Explainable Recommendation. ECML/PKDD (3) 2019: 339-355
[c161]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/0001S19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/0001S19
Nicola Ferro, Mark Sanderson:
Improving the Accuracy of System Performance Estimation by Using Shards. SIGIR 2019: 805-814
[c160]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/AwadallahGSW19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/AwadallahGSW19
Ahmed Hassan Awadallah, Cathal Gurrin, Mark Sanderson, Ryen W. White:
Task Intelligence Workshop @ WSDM 2019. WSDM 2019: 848-849
[i5]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1907-12700
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1907-12700
Ahmed Mourad, Falk Scholer, Walid Magdy, Mark Sanderson:
A Practical Guide for the Effective Evaluation of Twitter User Geolocation. CoRR abs/1907.12700 (2019)
[i4]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1910-13166
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1910-13166
Johanne R. Trippas, Damiano Spina, Paul Thomas, Mark Sanderson, Hideo Joho, Lawrence Cavedon:
Towards a Model for Spoken Conversational Search. CoRR abs/1910.13166 (2019)
[i3]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/dagstuhl-reports/AnandCJSS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/dagstuhl-reports/AnandCJSS19
Avishek Anand, Lawrence Cavedon, Hideo Joho, Mark Sanderson, Benno Stein:
Conversational Search (Dagstuhl Seminar 19461). Dagstuhl Reports 9(11): 34-83 (2019)
2018
[j64]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/epjds/RenTSCS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/epjds/RenTSCS18
Yongli Ren, Martin Tomko, Flora D. Salim, Jeffrey Chan, Mark Sanderson:
Understanding the predictability of user demographics from cyber-physical-social behaviours in indoor retail spaces. EPJ Data Sci. 7(1): 1 (2018)
[j63]
- view
  authority control:
- export record
  dblp key:
  - journals/tkde/YuliantiCSCS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tkde/YuliantiCSCS18
Evi Yulianti, Ruey-Cheng Chen, Falk Scholer, W. Bruce Croft, Mark Sanderson:
Document Summarization for Answering Non-Factoid Queries. IEEE Trans. Knowl. Data Eng. 30(1): 15-28 (2018)
[j62]
- view
  authority control:
- export record
  dblp key:
  - journals/tkde/RenTSCCS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tkde/RenTSCCS18
Yongli Ren, Martin Tomko, Flora Dilys Salim, Jeffrey Chan, Charles L. A. Clarke, Mark Sanderson:
A Location-Query-Browse Graph for Contextual Recommendation. IEEE Trans. Knowl. Data Eng. 30(2): 204-218 (2018)
[c159]
- view
  authority control:
- export record
  dblp key:
  - conf/asunam/MouradSSM18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asunam/MouradSSM18
Ahmed Mourad, Falk Scholer, Mark Sanderson, Walid Magdy:
How Well Did You Locate Me? Effective Evaluation of Twitter User Geolocation. ASONAM 2018: 437-440
[c158]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/TrippasSCJS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/TrippasSCJS18
Johanne R. Trippas, Damiano Spina, Lawrence Cavedon, Hideo Joho, Mark Sanderson:
Informing the Design of Spoken Conversational Search: Perspective Paper. CHIIR 2018: 32-41
[c157]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/OngJSS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/OngJSS18
Kevin Ong, Kalervo Järvelin, Mark Sanderson, Falk Scholer:
QWERTY: The Effects of Typing on Web Search Behavior. CHIIR 2018: 281-284
[c156]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/iir/SpinaMRSWBCMSSZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iir/SpinaMRSWBCMSSZ18
Damiano Spina, Maria Maistro, Yongli Ren, Sargol Sadeghi, Wilson Wong, Timothy Baldwin, Lawrence Cavedon, Alistair Moffat, Mark Sanderson, Falk Scholer, Justin Zobel:
A Preliminary Comparison of Job, Talent, and Web Search. IIR 2018
[c155]
- view
  authority control:
- export record
  dblp key:
  - conf/pakdd/PriyogiSSCTR18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pakdd/PriyogiSSCTR18
Bilih Priyogi, Mark Sanderson, Flora D. Salim, Jeffrey Chan, Martin Tomko, Yongli Ren:
Identifying In-App User Actions from Mobile Web Logs. PAKDD (2) 2018: 300-311
[c154]
- view
  authority control:
- export record
  dblp key:
  - conf/sensys/KaurSRCTS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sensys/KaurSRCTS18
Manpreet Kaur, Flora D. Salim, Yongli Ren, Jeffrey Chan, Martin Tomko, Mark Sanderson:
Shopping intent recognition and location prediction from cyber-physical activities via wi-fi logs. BuildSys 2018: 130-139
[c153]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/YuliantiCSCS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/YuliantiCSCS18
Evi Yulianti, Ruey-Cheng Chen, Falk Scholer, W. Bruce Croft, Mark Sanderson:
Ranking Documents by Answer-Passage Quality. SIGIR 2018: 335-344
[c152]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SalehiSMSSBCSWZ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SalehiSMSSBCSWZ18
Bahar Salehi, Damiano Spina, Alistair Moffat, Sargol Sadeghi, Falk Scholer, Timothy Baldwin, Lawrence Cavedon, Mark Sanderson, Wilson Wong, Justin Zobel:
A Living Lab Study of Query Amendment in Job Search. SIGIR 2018: 905-908
2017
[j61]
- view
  authority control:
- export record
  dblp key:
  - journals/chb/ShariffZS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/chb/ShariffZS17
Shafiza Mohd Shariff, Xiuzhen Zhang, Mark Sanderson:
On the credibility perception of news on Twitter: Readers, topics and features. Comput. Hum. Behav. 75: 785-796 (2017)
[j60]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/RenTSOS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/RenTSOS17
Yongli Ren, Martin Tomko, Flora Dilys Salim, Kevin Ong, Mark Sanderson:
Analyzing Web behavior in indoor retail spaces. J. Assoc. Inf. Sci. Technol. 68(1): 62-76 (2017)
[j59]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/SpinaTCS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/SpinaTCS17
Damiano Spina, Johanne R. Trippas, Lawrence Cavedon, Mark Sanderson:
Extracting audio summaries to support effective spoken document search. J. Assoc. Inf. Sci. Technol. 68(9): 2101-2115 (2017)
[j58]
- view
  authority control:
- export record
  dblp key:
  - journals/percom/RenSTBCQS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/percom/RenSTBCQS17
Yongli Ren, Flora Dilys Salim, Martin Tomko, Yuntian Brian Bai, Jeffrey Chan, Kyle Kai Qin, Mark Sanderson:
D-Log: A WiFi Log-based differential scheme for enhanced indoor localization with single RSSI source and infrequent sampling rate. Pervasive Mob. Comput. 37: 94-114 (2017)
[j57]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/SadeghiBMSSV17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/SadeghiBMSSV17
Seyedeh Sargol Sadeghi, Roi Blanco, Peter Mika, Mark Sanderson, Falk Scholer, David Vallet:
Re-Finding Behaviour in Vertical Domains. ACM Trans. Inf. Syst. 35(3): 21:1-21:30 (2017)
[c151]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/TrippasSCS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/TrippasSCS17
Johanne R. Trippas, Damiano Spina, Lawrence Cavedon, Mark Sanderson:
How Do People Interact in Conversational Speech-Only Search Tasks: A Preliminary Analysis. CHIIR 2017: 325-328
[c150]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/MouradSS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/MouradSS17
Ahmed Mourad, Falk Scholer, Mark Sanderson:
Language Influences on Tweeter Geolocation. ECIR 2017: 331-342
[c149]
- view
  authority control:
- export record
  dblp key:
  - conf/icde/WangBCSSQ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icde/WangBCSSQ17
Sheng Wang, Zhifeng Bao, J. Shane Culpepper, Timos Sellis, Mark Sanderson, Xiaolin Qin:
Answering Top-k Exemplar Trajectory Queries. ICDE 2017: 597-608
[c148]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/OngJSS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/OngJSS17
Kevin Ong, Kalervo Järvelin, Mark Sanderson, Falk Scholer:
Using Information Scent to Understand Mobile and Desktop Web Search Behavior. SIGIR 2017: 295-304
[c147]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShigaJBTS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShigaJBTS17
Sosuke Shiga, Hideo Joho, Roi Blanco, Johanne R. Trippas, Mark Sanderson:
Modelling Information Needs in Collaborative Search Conversations. SIGIR 2017: 715-724
[c146]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FerroS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FerroS17
Nicola Ferro, Mark Sanderson:
Sub-corpora Impact on System Effectiveness. SIGIR 2017: 901-904
[c145]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ChenYSC17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ChenYSC17
Ruey-Cheng Chen, Evi Yulianti, Mark Sanderson, W. Bruce Croft:
On the Benefit of Incorporating External Features in a Neural Architecture for Answer Sentence Selection. SIGIR 2017: 1017-1020
[c144]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/sigir/SpinaMRSWBCMSSZ17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SpinaMRSWBCMSSZ17
Damiano Spina, Maria Maistro, Yongli Ren, Sargol Sadeghi, Wilson Wong, Timothy Baldwin, Lawrence Cavedon, Alistair Moffat, Mark Sanderson, Falk Scholer, Justin Zobel:
Understanding User Behavior in Job and Talent Search: An Initial Investigation. eCOM@SIGIR 2017
[c143]
- view
  authority control:
- export record
  dblp key:
  - conf/socinfo/AladhadhZS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/socinfo/AladhadhZS17
Suliman Aladhadh, Xiuzhen Zhang, Mark Sanderson:
Beyond the Culture Effect on Credibility Perception on Microblogs. SocInfo (2) 2017: 316-328
[e12]
- view
- export record
  dblp key:
  - conf/cikm/2017
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/2017
Ee-Peng Lim, Marianne Winslett, Mark Sanderson, Ada Wai-Chee Fu, Jimeng Sun, J. Shane Culpepper, Eric Lo, Joyce C. Ho, Debora Donato, Rakesh Agrawal, Yu Zheng, Carlos Castillo, Aixin Sun, Vincent S. Tseng, Chenliang Li:
Proceedings of the 2017 ACM on Conference on Information and Knowledge Management, CIKM 2017, Singapore, November 06 - 10, 2017. ACM 2017, ISBN 978-1-4503-4918-5 [contents]
[r2]
- view
  authority control:
- export record
  dblp key:
  - reference/gis/Sanderson17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/gis/Sanderson17
Mark Sanderson:
Retrieval Algorithms, Spatial. Encyclopedia of GIS 2017: 1767-1774
2016
[j56]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/AminiMLS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/AminiMLS16
Iman Amini, David Martínez, Xiaodong Li, Mark Sanderson:
Improving patient record search: A meta-data based approach. Inf. Process. Manag. 52(2): 258-272 (2016)
[j55]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/YuliantiHS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/YuliantiHS16
Evi Yulianti, Sharin Huspi, Mark Sanderson:
Tweet-biased summarization. J. Assoc. Inf. Sci. Technol. 67(6): 1289-1300 (2016)
[j54]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/AldosariSTU16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/AldosariSTU16
Misfer Aldosari, Mark Sanderson, Audrey Tam, Alexandra L. Uitdenbogerd:
Understanding collaborative search for places of interest. J. Assoc. Inf. Sci. Technol. 67(6): 1331-1344 (2016)
[j53]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/KatoKKSS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/KatoKKSS16
Makoto P. Kato, Kazuaki Kishida, Noriko Kando, Tetsuya Sakai, Mark Sanderson:
Report on NTCIR-12: The Twelfth Round of NII Testbeds and Community for Information Access Research. SIGIR Forum 50(2): 18-27 (2016)
[j52]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/KharazmiSVS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/KharazmiSVS16
Sadegh Kharazmi, Falk Scholer, David Vallet, Mark Sanderson:
Examining Additivity and Weak Baselines. ACM Trans. Inf. Syst. 34(4): 23:1-23:18 (2016)
[c142]
- view
  - electronic edition @ acm.org
  - details & citations
- export record
  dblp key:
  - conf/adcs/WangBCSSY16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/WangBCSSY16
Sheng Wang, Zhifeng Bao, J. Shane Culpepper, Timos Sellis, Mark Sanderson, Munkh-Erdene Yadamjav:
Interactive Trip Planning Using Activity Trajectories. ADCS 2016: 77-80
[c141]
- view
  - electronic edition @ acm.org
  - details & citations
- export record
  dblp key:
  - conf/adcs/YuliantiCSS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/YuliantiCSS16
Evi Yulianti, Ruey-Cheng Chen, Falk Scholer, Mark Sanderson:
Using Semantic and Context Features for Answer Summary Extraction. ADCS 2016: 81-84
[c140]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LiSCS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LiSCS16
Pengfei Li, Mark Sanderson, Mark James Carman, Falk Scholer:
On the Effectiveness of Query Weighting for Adapting Rank Learners to New Unlabelled Collections. CIKM 2016: 1413-1422
[c139]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/ShariffSZ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/ShariffSZ16
Shafiza Mohd Shariff, Mark Sanderson, Xiuzhen Zhang:
Correlation Analysis of Reader's Demographics and Tweet Credibility Perception. ECIR 2016: 453-465
[c138]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/KandoSS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/KandoSS16
Noriko Kando, Tetsuya Sakai, Mark Sanderson:
Preface from NTCIR-12 General Chairs. NTCIR 2016
[c137]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/CarteretteCHKS16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/CarteretteCHKS16
Ben Carterette, Paul D. Clough, Mark M. Hall, Evangelos Kanoulas, Mark Sanderson:
Evaluating Retrieval over Sessions: The TREC Session Track 2011-2014. SIGIR 2016: 685-688
[e11]
- view
- export record
  dblp key:
  - conf/ntcir/2016
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/2016
Noriko Kando, Tetsuya Sakai, Mark Sanderson:
Proceedings of the 12th NTCIR Conference on Evaluation of Information Access Technologies, National Center of Sciences, Tokyo, Japan, June 7-10, 2016. National Institute of Informatics (NII) 2016 [contents]
2015
[j51]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/JayasingheWSDC15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/JayasingheWSDC15
Gaya K. Jayasinghe, William Webber, Mark Sanderson, Lasitha Sandamali Dharmasena, J. Shane Culpepper:
Statistical comparisons of non-deterministic IR systems using two dimensional variance. Inf. Process. Manag. 51(5): 677-694 (2015)
[j50]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/VrettasS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/VrettasS15
George Vrettas, Mark Sanderson:
Conferences versus journals in computer science. J. Assoc. Inf. Sci. Technol. 66(12): 2674-2684 (2015)
[c136]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/Sanderson15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/Sanderson15
Mark Sanderson:
Hands and Eyes Free Search. NWSearch@CIKM 2015: 11
[c135]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/TrippasSSC15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/TrippasSSC15
Johanne R. Trippas, Damiano Spina, Mark Sanderson, Lawrence Cavedon:
Results Presentation Methods for a Spoken Conversational Search System. NWSearch@CIKM 2015: 13-15
[c134]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ChenSCSS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ChenSCSS15
Ruey-Cheng Chen, Damiano Spina, W. Bruce Croft, Mark Sanderson, Falk Scholer:
Harnessing Semantics for Answer Sentence Retrieval. ESAIR@CIKM 2015: 21-27
[c133]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/JonesSTMS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/JonesSTMS15
Timothy Jones, Falk Scholer, Andrew Turpin, Stefano Mizzaro, Mark Sanderson:
Different Rankers on Different Subcollections. ECIR 2015: 203-208
[c132]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SadeghiBMSSV15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SadeghiBMSSV15
Sargol Sadeghi, Roi Blanco, Peter Mika, Mark Sanderson, Falk Scholer, David Vallet:
Predicting Re-finding Activity and Difficulty. ECIR 2015: 715-727
[c131]
- view
  authority control:
- export record
  dblp key:
  - conf/mm/SpinaTCS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mm/SpinaTCS15
Damiano Spina, Johanne R. Trippas, Lawrence Cavedon, Mark Sanderson:
SpeakerLDA: Discovering Topics in Transcribed Multi-Speaker Audio Contents. SLAM@ACM Multimedia 2015: 7-10
[c130]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JonesTSS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JonesTSS15
Timothy Jones, Paul Thomas, Falk Scholer, Mark Sanderson:
Features of Disagreement Between Retrieval Effectiveness Measures. SIGIR 2015: 847-850
[c129]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TrippasSSC15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TrippasSSC15
Johanne R. Trippas, Damiano Spina, Mark Sanderson, Lawrence Cavedon:
Towards Understanding the Impact of Length in Web Search Result Summaries over a Speech-only Communication Channel. SIGIR 2015: 991-994
[i2]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/RenTSOS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/RenTSOS15
Yongli Ren, Martin Tomko, Flora D. Salim, Kevin Ong, Mark Sanderson:
Analyzing Web Behavior in Indoor Retail Spaces. CoRR abs/1506.05628 (2015)
2014
[j49]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/AloteibiS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/AloteibiS14
Saad Aloteibi, Mark Sanderson:
Analyzing geographic query reformulation: An exploratory study. J. Assoc. Inf. Sci. Technol. 65(1): 13-24 (2014)
[j48]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CappellatoCFHHHKKLSTV14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CappellatoCFHHHKKLSTV14
Linda Cappellato, Paul D. Clough, Nicola Ferro, Mark M. Hall, Martin Halvey, Allan Hanbury, Evangelos Kanoulas, Wessel Kraaij, Mihai Lupu, Mark Sanderson, Elaine Toms, Robert Villa:
CLEF 2014: Information Access Evaluation meets Multilinguality, Multimodality, and Interaction. SIGIR Forum 48(2): 56-62 (2014)
[c128]
- view
  authority control:
- export record
  dblp key:
  - conf/adc/ZhouZS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adc/ZhouZS14
Zhixin Zhou, Xiuzhen Zhang, Mark Sanderson:
Sentiment Analysis on Twitter through Topic-Based Lexicon Expansion. ADC 2014: 98-109
[c127]
- view
  authority control:
- export record
  dblp key:
  - conf/adcs/JayasingheWSC14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/JayasingheWSC14
Gaya K. Jayasinghe, William Webber, Mark Sanderson, J. Shane Culpepper:
Improving test collection pools with machine learning. ADCS 2014: 2
[c126]
- view
  authority control:
- export record
  dblp key:
  - conf/adcs/SchandaSC14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/SchandaSC14
Johannes Schanda, Mark Sanderson, Paul D. Clough:
Examining New Event Detection. ADCS 2014: 26
[c125]
- view
  authority control:
- export record
  dblp key:
  - conf/adcs/AladhadhZS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/AladhadhZS14
Suliman Aladhadh, Xiuzhen Zhang, Mark Sanderson:
Tweet Author Location Impacts on Tweet Credibility. ADCS 2014: 73
[c124]
- view
  authority control:
- export record
  dblp key:
  - conf/adcs/KeikhaPCS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/KeikhaPCS14
Mostafa Keikha, Jae Hyun Park, W. Bruce Croft, Mark Sanderson:
Retrieving Passages and Finding Answers. ADCS 2014: 81
[c123]
- view
  authority control:
- export record
  dblp key:
  - conf/adcs/SadeghiBMSSV14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/SadeghiBMSSV14
Sargol Sadeghi, Roi Blanco, Peter Mika, Mark Sanderson, Falk Scholer, David Vallet:
Identifying Re-finding Difficulty from User Query Logs. ADCS 2014: 105
[c122]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/JonesTMSS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/JonesTMSS14
Timothy Jones, Andrew Turpin, Stefano Mizzaro, Falk Scholer, Mark Sanderson:
Size and Source Matter: Understanding Inconsistencies in Test Collection-Based Evaluation. CIKM 2014: 1843-1846
[c121]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/RenTOS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/RenTOS14
Yongli Ren, Martin Tomko, Kevin Ong, Mark Sanderson:
How People Use the Web in Large Indoor Spaces. CIKM 2014: 1879-1882
[c120]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/ShariffZS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/ShariffZS14
Shafiza Mohd Shariff, Xiuzhen Zhang, Mark Sanderson:
User Perception of Information Credibility of News on Twitter. ECIR 2014: 513-518
[c119]
- view
  authority control:
- export record
  dblp key:
  - conf/ipin/BaiWRORKTSWZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ipin/BaiWRORKTSWZ14
Yuntian Brian Bai, Suqin Wu, Yongli Ren, Kevin Ong, Günther Retscher, Allison Kealy, Martin Tomko, Mark Sanderson, Hong Ren Wu, Kefei Zhang:
A new approach for indoor customer tracking based on a single Wi-Fi connection. IPIN 2014: 239-245
[c118]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/KandoKSOS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/KandoKSOS14
Noriko Kando, Tsuneaki Kato, Tetsuya Sakai, Douglas W. Oard, Mark Sanderson:
Preface from NTCIR-11 General Chairs. NTCIR 2014
[c117]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JayasingheWSDC14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JayasingheWSDC14
Gaya K. Jayasinghe, William Webber, Mark Sanderson, Lasitha Sandamali Dharmasena, J. Shane Culpepper:
Evaluating non-deterministic retrieval systems. SIGIR 2014: 911-914
[c116]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JayasingheWSC14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JayasingheWSC14
Gaya K. Jayasinghe, William Webber, Mark Sanderson, J. Shane Culpepper:
Extending test collection pools without manual runs. SIGIR 2014: 915-918
[c115]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KharazmiSSV14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KharazmiSSV14
Sadegh Kharazmi, Mark Sanderson, Falk Scholer, David Vallet:
Using score differences for search result diversification. SIGIR 2014: 1143-1146
[c114]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/CulpepperMSS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/CulpepperMSS14
J. Shane Culpepper, Stefano Mizzaro, Mark Sanderson, Falk Scholer:
TREC: topic engineering exercise. SIGIR 2014: 1147-1150
[e10]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/2014
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/2014
Evangelos Kanoulas, Mihai Lupu, Paul D. Clough, Mark Sanderson, Mark M. Hall, Allan Hanbury, Elaine G. Toms:
Information Access Evaluation. Multilinguality, Multimodality, and Interaction - 5th International Conference of the CLEF Initiative, CLEF 2014, Sheffield, UK, September 15-18, 2014. Proceedings. Lecture Notes in Computer Science 8685, Springer 2014, ISBN 978-3-319-11381-4 [contents]
2013
[j47]
- view
  authority control:
- export record
  dblp key:
  - journals/aslib/SedghiSC13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aslib/SedghiSC13
Shahram Sedghi, Mark Sanderson, Paul D. Clough:
How do healthcare professionals select the medical images they need? Aslib Proc. 65(1): 54-72 (2013)
[j46]
- view
  authority control:
- export record
  dblp key:
  - journals/internet/CloughSTGW13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/internet/CloughSTGW13
Paul D. Clough, Mark Sanderson, Jiayu Tang, Tim Gollins, Amy Warner:
Examining the Limits of Crowdsourcing for Relevance Assessment. IEEE Internet Comput. 17(4): 32-38 (2013)
[j45]
- view
  - electronic edition @ informationr.net (open access)
  - details & citations
- export record
  dblp key:
  - journals/ires/CloughS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ires/CloughS13
Paul D. Clough, Mark Sanderson:
Evaluating the performance of information retrieval systems using test collections. Inf. Res. 18(2) (2013)
[j44]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/Wan-ChikCS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/Wan-ChikCS13
Rita Wan-Chik, Paul D. Clough, Mark Sanderson:
Investigating religious information searching through analysis of a search engine log. J. Assoc. Inf. Sci. Technol. 64(12): 2492-2506 (2013)
[j43]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/BellotDGGKKKMMMPSSTTTTSSW13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/BellotDGGKKKMMMPSSTTTTSSW13
Patrice Bellot, Antoine Doucet, Shlomo Geva, Sairam Gurajada, Jaap Kamps, Gabriella Kazai, Marijn Koolen, Arunav Mishra, Véronique Moriceau, Josiane Mothe, Michael Preminger, Eric SanJuan, Ralf Schenkel, Xavier Tannier, Martin Theobald, Matthew Trappett, Andrew Trotman, Mark Sanderson, Falk Scholer, Qiuyue Wang:
Report on INEX 2013. SIGIR Forum 47(2): 21-32 (2013)
[c113]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/TrappettGTSS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/TrappettGTSS13
Matthew Trappett, Shlomo Geva, Andrew Trotman, Falk Scholer, Mark Sanderson:
Overview of the INEX 2013 Snippet Retrieval Track. CLEF (Working Notes) 2013
[c112]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/KandoKOS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/KandoKOS13
Noriko Kando, Tsuneaki Kato, Douglas W. Oard, Mark Sanderson:
Preface from NTCIR-10 General Chairs. NTCIR 2013
[c111]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/SadeghiSS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/SadeghiSS13
Sargol Sadeghi, Mark Sanderson, Falk Scholer:
User Perception of Search Task Differentiation. EVIA@NTCIR 2013
[p4]
- view
  authority control:
- export record
  dblp key:
  - books/sp/13/ParamitaGKGCS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/13/ParamitaGKGCS13
Monica Lestari Paramita, David Guthrie, Evangelos Kanoulas, Robert J. Gaizauskas, Paul D. Clough, Mark Sanderson:
Methods for Collection and Evaluation of Comparable Documents. Building and Using Comparable Corpora 2013: 93-112
2012
[j42]
- view
  authority control:
- export record
  dblp key:
  - journals/aslib/SedghiSC12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aslib/SedghiSC12
Shahram Sedghi, Mark Sanderson, Paul D. Clough:
How do health care professionals select medical images they need? Aslib Proc. 64(4): 437-456 (2012)
[j41]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/pieee/SandersonC12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/pieee/SandersonC12
Mark Sanderson, W. Bruce Croft:
The History of Information Retrieval Research. Proc. IEEE 100(Centennial-Issue): 1444-1451 (2012)
[j40]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AllanCMS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AllanCMS12
James Allan, W. Bruce Croft, Alistair Moffat, Mark Sanderson:
Frontiers, challenges, and opportunities for information retrieval: Report from SWIRL 2012 the second strategic workshop on information retrieval in Lorne. SIGIR Forum 46(1): 2-32 (2012)
[j39]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/BellotCDGKKKLMMMRSSSTTTTW12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/BellotCDGKKKLMMMRSSSTTTTW12
Patrice Bellot, Timothy Chappell, Antoine Doucet, Shlomo Geva, Jaap Kamps, Gabriella Kazai, Marijn Koolen, Monica Landoni, Maarten Marx, Véronique Moriceau, Josiane Mothe, Georgina Ramírez, Mark Sanderson, Eric SanJuan, Falk Scholer, Xavier Tannier, Martin Theobald, Matthew Trappett, Andrew Trotman, Qiuyue Wang:
Report on INEX 2011. SIGIR Forum 46(1): 33-42 (2012)
[j38]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/BellotCDGGKKKLMMMMPRSSSSTTTTW12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/BellotCDGGKKKLMMMMPRSSSSTTTTW12
Patrice Bellot, Timothy Chappell, Antoine Doucet, Shlomo Geva, Sairam Gurajada, Jaap Kamps, Gabriella Kazai, Marijn Koolen, Monica Landoni, Maarten Marx, Arunav Mishra, Véronique Moriceau, Josiane Mothe, Michael Preminger, Georgina Ramírez, Mark Sanderson, Eric SanJuan, Falk Scholer, A. Schuh, Xavier Tannier, Martin Theobald, Matthew Trappett, Andrew Trotman, Qiuyue Wang:
Report on INEX 2012. SIGIR Forum 46(2): 50-59 (2012)
[c110]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/BergmanWSNR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/BergmanWSNR12
Ofer Bergman, Steve Whittaker, Mark Sanderson, Rafi Nachmias, Anand Ramamoorthy:
How do we find personal files?: the effect of OS, presentation & depth on file navigation. CHI 2012: 2977-2980
[c109]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/SandersonTZS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/SandersonTZS12
Mark Sanderson, Andrew Turpin, Ying Zhang, Falk Scholer:
Differences in effectiveness across sub-collections. CIKM 2012: 1965-1969
[c108]
- view
- export record
  dblp key:
  - conf/clef/TrappettGTSS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/TrappettGTSS12
Matthew Trappett, Shlomo Geva, Andrew Trotman, Falk Scholer, Mark Sanderson:
Overview of the INEX 2012 Snippet Retrieval Track. CLEF (Online Working Notes/Labs/Workshop) 2012
[c107]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/AkerFSG12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/AkerFSG12
Ahmet Aker, Xin Fan, Mark Sanderson, Robert J. Gaizauskas:
Investigating Summarization Techniques for Geo-Tagged Image Indexing. ECIR 2012: 472-475
[c106]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/eurohcir/SadeghiSS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eurohcir/SadeghiSS12
Seyedeh Sargol Sadeghi, Mark Sanderson, Falk Scholer:
From Task-based Evaluation to Feature-based Evaluation in Personal Search. EuroHCIR 2012: 41-42
[c105]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/AminiSLM12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/AminiSLM12
Iman Amini, Mark Sanderson, Xiaodong Li, David Martínez:
Using Meda-data to Search for Clinical Records: RMIT at TREC 2012 Medical Track. TREC 2012
[c104]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/KanoulasCHCS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/KanoulasCHCS12
Evangelos Kanoulas, Ben Carterette, Mark M. Hall, Paul D. Clough, Mark Sanderson:
Overview of the TREC 2012 Session Track. TREC 2012
[e9]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/2012
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/2012
William R. Hersh, Jamie Callan, Yoelle Maarek, Mark Sanderson:
The 35th International ACM SIGIR conference on research and development in Information Retrieval, SIGIR '12, Portland, OR, USA, August 12-16, 2012. ACM 2012, ISBN 978-1-4503-1472-5 [contents]
[i1]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - journals/shonan-reports/BelkinDKS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/shonan-reports/BelkinDKS12
Nicholas J. Belkin, Susan T. Dumais, Noriko Kando, Mark Sanderson:
Whole-Session Evaluation of Interactive Information Retrieval Systems (NII Shonan Meeting 2012-7). NII Shonan Meet. Rep. 2012 (2012)
2011
[j37]
- view
  authority control:
- export record
  dblp key:
  - journals/aslib/SedghiSC11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aslib/SedghiSC11
Shahram Sedghi, Mark Sanderson, Paul D. Clough:
Medical image resources used by health care professionals. Aslib Proc. 63(6): 570-585 (2011)
[j36]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/Al-MaskariS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/Al-MaskariS11
Azzah Al-Maskari, Mark Sanderson:
The effect of user characteristics on search effectiveness in information retrieval. Inf. Process. Manag. 47(5): 719-729 (2011)
[j35]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CarteretteCKS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CarteretteCKS11
Ben Carterette, Paul D. Clough, Evangelos Kanoulas, Mark Sanderson:
Report on the ECIR 2011 workshop on information retrieval over query sessions. SIGIR Forum 45(2): 76-80 (2011)
[j34]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/PedroSS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/PedroSS11
José San Pedro, Stefan Siersdorfer, Mark Sanderson:
Content redundancy in YouTube and its application to video tagging. ACM Trans. Inf. Syst. 29(3): 13:1-13:31 (2011)
[c103]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/ZobelWSM11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/ZobelWSM11
Justin Zobel, William Webber, Mark Sanderson, Alistair Moffat:
Principles for robust evaluation infrastructure. DESIRE@CIKM 2011: 3-6
[c102]
- view
  authority control:
- export record
  dblp key:
  - conf/inex/TrappettGTSS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inex/TrappettGTSS11
Matthew Trappett, Shlomo Geva, Andrew Trotman, Falk Scholer, Mark Sanderson:
Overview of the INEX 2011 Snippet Retrieval Track. INEX 2011: 283-294
[c101]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/KishidaSW11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/KishidaSW11
Kazuaki Kishida, Mark Sanderson, William Webber:
Preface. EVIA@NTCIR 2011
[c100]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/SandersonWSJTGF11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/SandersonWSJTGF11
Mark Sanderson, William Webber, Ian Soboroff, Gareth J. F. Jones, Andrew Trotman, Shlomo Geva, Nicola Ferro, Hideo Joho:
Reports from Other Evaluation Campaigns and Panel Discussion: TREC is 20 Years Old, Where Now for Evaluation Campaigns? EVIA@NTCIR 2011
[c99]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KanoulasCCS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KanoulasCCS11
Evangelos Kanoulas, Ben Carterette, Paul D. Clough, Mark Sanderson:
Evaluating multi-query sessions. SIGIR 2011: 1053-1062
[c98]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ScholerTS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ScholerTS11
Falk Scholer, Andrew Turpin, Mark Sanderson:
Quantifying test collection quality based on the consistency of relevance judgements. SIGIR 2011: 1063-1072
[c97]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/AminiSML11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/AminiSML11
Iman Amini, Mark Sanderson, David Martínez, Xiaodong Li:
Search for Clinical Records: RMIT at Medical TREC. TREC 2011
[c96]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/KanoulasHCCS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/KanoulasHCCS11
Evangelos Kanoulas, Mark M. Hall, Paul D. Clough, Ben Carterette, Mark Sanderson:
Overview of the TREC 2011 Session Track. TREC 2011
[c95]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/LealKDSSSA11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/LealKDSSSA11
Lorena Leal Bando, Sadegh Kharazmi, Jasbir Dhaliwal, Mark Sanderson, Falk Scholer, Sargol Sadeghi, Fahad Alahmari:
RMIT at TREC 2011 Session Track. TREC 2011
[c94]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/PetriSS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/PetriSS11
Matthias Petri, Mark Sanderson, Falk Scholer:
RMIT at the Crowdsourcing Track of TREC 2011. TREC 2011
[p3]
- view
  authority control:
- export record
  dblp key:
  - books/sp/11/SandersonW11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/11/SandersonW11
Mark Sanderson, Amy Warner:
Training Students to Evaluate Search Engines. Teaching and Learning in Information Retrieval 2011: 169-182
[e8]
- view
- export record
  dblp key:
  - conf/ntcir/2011evia
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/2011evia
Kazuaki Kishida, Mark Sanderson, William Webber:
Proceedings of the 4th International Workshop on Evaluating Information Access, EVIA 2011, National Center of Sciences, Tokyo, Japan, December 6, 2011. National Institute of Informatics (NII) 2011, ISBN 978-4-86049-057-7 [contents]
2010
[j33]
- view
  authority control:
- export record
  dblp key:
  - journals/ftir/Sanderson10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ftir/Sanderson10
Mark Sanderson:
Test Collection Based Evaluation of Information Retrieval Systems. Found. Trends Inf. Retr. 4(4): 247-375 (2010)
[j32]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/Al-MaskariS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/Al-MaskariS10
Azzah Al-Maskari, Mark Sanderson:
A review of factors influencing user satisfaction in information retrieval. J. Assoc. Inf. Sci. Technol. 61(5): 859-868 (2010)
[j31]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/LeeS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/LeeS10
Wei Meng Lee, Mark Sanderson:
Analyzing URL queries. J. Assoc. Inf. Sci. Technol. 61(11): 2300-2310 (2010)
[j30]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/BergmanWSNR10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/BergmanWSNR10
Ofer Bergman, Steve Whittaker, Mark Sanderson, Rafi Nachmias, Anand Ramamoorthy:
The effect of folder structure on personal file navigation. J. Assoc. Inf. Sci. Technol. 61(12): 2426-2441 (2010)
[j29]
- view
  authority control:
- export record
  dblp key:
  - journals/joi/LiSWNO10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/joi/LiSWNO10
Jiang Li, Mark Sanderson, Peter Willett, Michael Norris, Charles Oppenheim:
Ranking of library and information science researchers: Comparison of data sources for correlating citation data, and expert judgments. J. Informetrics 4(4): 554-563 (2010)
[j28]
- view
  authority control:
- export record
  dblp key:
  - journals/nle/Sanderson10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nle/Sanderson10
Mark Sanderson:
Christopher D. Manning, Prabhakar Raghavan, Hinrich Schütze, Introduction to Information Retrieval, Cambridge University Press 2008. ISBN-13 978-0-521-86571-5, xxi + 482 pages. Nat. Lang. Eng. 16(1): 100-103 (2010)
[j27]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/WebberSS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/WebberSS10
William Webber, Tetsuya Sakai, Mark Sanderson:
EVIA 2010: the third international workshop on evaluating information access. SIGIR Forum 44(2): 67-72 (2010)
[c93]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/TangS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/TangS10
Jiayu Tang, Mark Sanderson:
Evaluation and User Preference Study on Spatial Diversity. ECIR 2010: 179-190
[c92]
- view
  authority control:
- export record
  dblp key:
  - conf/gir/TangS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/gir/TangS10
Jiayu Tang, Mark Sanderson:
Spatial diversity, do users appreciate it? GIR 2010
[c91]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/ifip8/FarhanS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ifip8/FarhanS10
Huda R. Farhan, Mark Sanderson:
User's Satisfaction of Kuwait E-Government Portal: Organization of Information in Particular. EGES/GISP 2010: 201-209
[c90]
- view
  authority control:
- export record
  dblp key:
  - conf/mir/FanATSSG10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mir/FanATSSG10
Xin Fan, Ahmet Aker, Martin Tomko, Philip Smart, Mark Sanderson, Robert J. Gaizauskas:
Automatic image captioning from the web for GPS photographs. Multimedia Information Retrieval 2010: 445-448
[c89]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/SakaiSW10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/SakaiSW10
Tetsuya Sakai, Mark Sanderson, William Webber:
Preface. EVIA@NTCIR 2010: i
[c88]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonPCK10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonPCK10
Mark Sanderson, Monica Lestari Paramita, Paul D. Clough, Evangelos Kanoulas:
Do user preferences and evaluation measures line up? SIGIR 2010: 555-562
[c87]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/KanoulasCCS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/KanoulasCCS10
Evangelos Kanoulas, Paul D. Clough, Ben Carterette, Mark Sanderson:
Overview of the TREC 2010 Session Track. TREC 2010
[p2]
- view
  authority control:
- export record
  dblp key:
  - books/daglib/p/CloughMS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/daglib/p/CloughMS10
Paul D. Clough, Henning Müller, Mark Sanderson:
Seven Years of Image Retrieval Evaluation. ImageCLEF 2010: 3-18
[p1]
- view
  authority control:
- export record
  dblp key:
  - books/daglib/p/Sanderson10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/daglib/p/Sanderson10
Mark Sanderson:
Performance Measures Used in Image Information Retrieval. ImageCLEF 2010: 81-94
[e7]
- view
- export record
  dblp key:
  - conf/ntcir/2010evia
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/2010evia
Tetsuya Sakai, Mark Sanderson, William Webber:
Proceedings of the 3rd International Workshop on Evaluating Information Access, EVIA 2010, National Center of Sciences, Tokyo, Japan, June 15, 2010. National Institute of Informatics (NII) 2010, ISBN 978-4-86049-054-6 [contents]

2000 – 2009

see FAQ

What is the meaning of the colors in the publication lists?

2009
[j26]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/TannS09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/TannS09
Chadwyn Tann, Mark Sanderson:
Are Web-based informational queries changing? J. Assoc. Inf. Sci. Technol. 60(6): 1290-1293 (2009)
[j25]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/RodaZLJSW09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/RodaZLJSW09
Giovanna Roda, Veronika Zenz, Mihai Lupu, Kalervo Järvelin, Mark Sanderson, Christa Womser-Hacker:
So many topics, so little time. SIGIR Forum 43(1): 9-16 (2009)
[j24]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/SakaiSK09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/SakaiSK09
Tetsuya Sakai, Mark Sanderson, Noriko Kando:
EVIA 2008: the second international workshop on evaluating information access. SIGIR Forum 43(1): 56-62 (2009)
[j23]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/Sanderson09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/Sanderson09
Mark Sanderson:
Workshop on novel methodologies for evaluation in information retrieval: held at ECIR 2008, Glasgow, UK, 30th March, 2008. SIGIR Forum 43(1): 66-69 (2009)
[c86]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/ParamitaSC09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/ParamitaSC09
Monica Lestari Paramita, Mark Sanderson, Paul D. Clough:
Diversity in Photo Retrieval: Overview of the ImageCLEFPhoto Task 2009. CLEF (2) 2009: 45-59
[c85]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/ParamitaSC09a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/ParamitaSC09a
Monica Lestari Paramita, Mark Sanderson, Paul D. Clough:
Diversity in Photo Retrieval: Overview of the ImageCLEFPhoto Task 2009. CLEF (Working Notes) 2009
[c84]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SandersonTAC09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SandersonTAC09
Mark Sanderson, Jiayu Tang, Thomas Arni, Paul D. Clough:
What Else Is There? Search Diversity Examined. ECIR 2009: 562-569
[c83]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/ParamitaTS09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/ParamitaTS09
Monica Lestari Paramita, Jiayu Tang, Mark Sanderson:
Generic and Spatial Approaches to Image Search Results Diversification. ECIR 2009: 603-610
[c82]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SiersdorferPS09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SiersdorferPS09
Stefan Siersdorfer, José San Pedro, Mark Sanderson:
Automatic video tagging using content redundancy. SIGIR 2009: 395-402
[c81]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/CloughSANP09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/CloughSANP09
Paul D. Clough, Mark Sanderson, Murad Abouammoh, Sergio Navarro, Monica Lestari Paramita:
Multiple approaches to analysing query diversity. SIGIR 2009: 734-735
[e6]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/2009
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/2009
James Allan, Javed A. Aslam, Mark Sanderson, ChengXiang Zhai, Justin Zobel:
Proceedings of the 32nd Annual International ACM SIGIR Conference on Research and Development in Information Retrieval, SIGIR 2009, Boston, MA, USA, July 19-23, 2009. ACM 2009, ISBN 978-1-60558-483-6 [contents]
2008
[j22]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/CrestaniFS08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/CrestaniFS08
Fabio Crestani, Paolo Ferragina, Mark Sanderson:
Preface. Inf. Retr. 11(4): 267-268 (2008)
[j21]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/Sanderson08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/Sanderson08
Mark Sanderson:
Revisiting h measured on UK LIS and IR academics. J. Assoc. Inf. Sci. Technol. 59(7): 1184-1190 (2008)
[j20]
- view
  authority control:
- export record
  dblp key:
  - journals/prl/SedghiSC08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/prl/SedghiSC08
Shahram Sedghi, Mark Sanderson, Paul D. Clough:
A study on the relevance criteria for medical images. Pattern Recognit. Lett. 29(15): 2046-2057 (2008)
[c80]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/ArniCSG08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/ArniCSG08
Thomas Arni, Paul D. Clough, Mark Sanderson, Michael Grubinger:
Overview of the ImageCLEFphoto 2008 Photographic Retrieval Task. CLEF 2008: 500-511
[c79]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/ArniCSG08a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/ArniCSG08a
Thomas Arni, Paul D. Clough, Mark Sanderson, Michael Grubinger:
Overview of the ImageCLEFphoto 2008 Photographic Retrieval Task. CLEF (Working Notes) 2008
[c78]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/TangASC08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/TangASC08
Jiayu Tang, Thomas Arni, Mark Sanderson, Paul D. Clough:
Building a Diversity Featured Search System by Fusing Existing Tools. CLEF 2008: 560-567
[c77]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/TangASC08a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/TangASC08a
Jiayu Tang, Thomas Arni, Mark Sanderson, Paul D. Clough:
Building a Diversity Featured Search System by Fusing Existing Tools. CLEF (Working Notes) 2008
[c76]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SandersonBFG08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SandersonBFG08
Mark Sanderson, Martin Braschler, Nicola Ferro, Julio Gonzalo:
Workshop on Novel Methodologies for Evaluation in Information Retrieval. ECIR 2008: 713
[c75]
- view
  - electronic edition @ lrec-conf.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/lrec/MandlGNFSSW08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/MandlGNFSSW08
Thomas Mandl, Fredric C. Gey, Giorgio Maria Di Nunzio, Nicola Ferro, Mark Sanderson, Diana Santos, Christa Womser-Hacker:
An Evaluation Resource for Geographic Information Retrieval. LREC 2008
[c74]
- view
  - electronic edition @ lrec-conf.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/lrec/PetersBNFGS08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/PetersBNFGS08
Carol Peters, Martin Braschler, Giorgio Maria Di Nunzio, Nicola Ferro, Julio Gonzalo, Mark Sanderson:
From Research to Application in Multilingual Information Access: the Contribution of Evaluation. LREC 2008
[c73]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/Sanderson08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/Sanderson08
Mark Sanderson:
Summing Up. NTCIR 2008
[c72]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Al-MaskariSCA08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Al-MaskariSCA08
Azzah Al-Maskari, Mark Sanderson, Paul D. Clough, Eija Airio:
The good and the bad system: does the test collection predict users' effectiveness? SIGIR 2008: 59-66
[c71]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Sanderson08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Sanderson08
Mark Sanderson:
Ambiguous queries: test collections need more sense. SIGIR 2008: 499-506
[c70]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Al-MaskariSC08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Al-MaskariSC08
Azzah Al-Maskari, Mark Sanderson, Paul D. Clough:
Relevance judgments between TREC and Non-TREC assessors. SIGIR 2008: 683-684
[e5]
- view
- export record
  dblp key:
  - conf/ntcir/2008evia
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/2008evia
Tetsuya Sakai, Mark Sanderson, Noriko Kando:
Proceedings of the 2nd International Workshop on Evaluating Information Access, EVIA 2008, National Center of Sciences, Tokyo, Japan, December 16, 2008. National Institute of Informatics (NII) 2008 [contents]
[r1]
- view
  authority control:
- export record
  dblp key:
  - reference/gis/Sanderson08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/gis/Sanderson08
Mark Sanderson:
Retrieval Algorithms, Spatial. Encyclopedia of GIS 2008: 961-966
2007
[j19]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/JonesRS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/JonesRS07
Karen Sparck Jones, Stephen E. Robertson, Mark Sanderson:
Ambiguous requests: implications for retrieval tests, systems and theories. SIGIR Forum 41(2): 8-17 (2007)
[j18]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CallanACDESZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CallanACDESZ07
Jamie Callan, James Allan, Charles L. A. Clarke, Susan T. Dumais, David A. Evans, Mark Sanderson, ChengXiang Zhai:
Meeting of the MINDS: an information retrieval research agenda. SIGIR Forum 41(2): 25-34 (2007)
[j17]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/ZwolRSM07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/ZwolRSM07
Roelof van Zwol, Stefan M. Rüger, Mark Sanderson, Yosi Mass:
Multimedia information retrieval: "new challenges in audio visual search". SIGIR Forum 41(2): 77-82 (2007)
[j16]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/SandersonSK07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/SandersonSK07
Mark Sanderson, Tetsuya Sakai, Noriko Kando:
EVIA 2007: the First International Workshop on Evaluating Information Access. SIGIR Forum 41(2): 109-111 (2007)
[c69]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/MandlGNFLSSWX07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/MandlGNFLSSWX07
Thomas Mandl, Fredric C. Gey, Giorgio Maria Di Nunzio, Nicola Ferro, Ray R. Larson, Mark Sanderson, Diana Santos, Christa Womser-Hacker, Xing Xie:
GeoCLEF 2007: The CLEF 2007 Cross-Language Geographic Information Retrieval Track Overview. CLEF 2007: 745-772
[c68]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/MandlGNFLSSWX07a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/MandlGNFLSSWX07a
Thomas Mandl, Fredric C. Gey, Giorgio Maria Di Nunzio, Nicola Ferro, Ray R. Larson, Mark Sanderson, Diana Santos, Christa Womser-Hacker, Xing Xie:
GeoCLEF 2007: the CLEF 2007 Cross-Language Geographic Information Retrieval Track Overview. CLEF (Working Notes) 2007
[c67]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SandersonS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SandersonS07
Mark Sanderson, Xiao Mang Shou:
Search of Spoken Documents Retrieves Well Recognized Transcripts. ECIR 2007: 505-516
[c66]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SandersonD07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SandersonD07
Mark Sanderson, Susan T. Dumais:
Examining Repetition in User Search Behavior. ECIR 2007: 597-604
[c65]
- view
  authority control:
- export record
  dblp key:
  - conf/gir/SandersonH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/gir/SandersonH07
Mark Sanderson, Yu Han:
Search words and geography. GIR 2007: 13-14
[c64]
- view
  authority control:
- export record
  dblp key:
  - conf/gir/PasleyCS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/gir/PasleyCS07
Robert C. Pasley, Paul D. Clough, Mark Sanderson:
Geo-tagging for imprecise regions of different sizes. GIR 2007: 77-82
[c63]
- view
  authority control:
- export record
  dblp key:
  - conf/gir/CloughPSPS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/gir/CloughPSPS07
Paul D. Clough, Robert C. Pasley, Stefan Siersdorfer, José San Pedro, Mark Sanderson:
Visualising the south Yorkshire floods of '07. GIR 2007: 93-94
[c62]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/GeyLSBMWSRMNF07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/GeyLSBMWSRMNF07
Fredric C. Gey, Ray R. Larson, Mark Sanderson, Kerstin Bischoff, Thomas Mandl, Christa Womser-Hacker, Diana Santos, Paulo Rocha, Andrés Montoyo, Giorgio Maria Di Nunzio, Nicola Ferro:
Challenges to Evaluation of Multilingual Geographic Information Retrieval in GeoCLEF. EVIA@NTCIR 2007
[c61]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/Sanderson07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/Sanderson07
Mark Sanderson:
Test collections for all. NTCIR 2007
[c60]
- view
  authority control:
- export record
  dblp key:
  - conf/riao/JohoS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/riao/JohoS07
Hideo Joho, Mark Sanderson:
Document frequency and term specificity. RIAO 2007: 350-359
[c59]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Al-MaskariSC07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Al-MaskariSC07
Azzah Al-Maskari, Mark Sanderson, Paul D. Clough:
The relationship between IR effectiveness measures and user satisfaction. SIGIR 2007: 773-774
[c58]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonS07
Mark Sanderson, Ian Soboroff:
Problems with Kendall's tau. SIGIR 2007: 839-840
2006
[j15]
- view
  authority control:
- export record
  dblp key:
  - journals/dke/HedleyYJS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/dke/HedleyYJS06
Yih-Ling Hedley, Muhammad Younas, Anne E. James, Mark Sanderson:
Sampling, information extraction and summarisation of Hidden Web databases. Data Knowl. Eng. 59(2): 213-230 (2006)
[j14]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/CloughS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/CloughS06
Paul D. Clough, Mark Sanderson:
User experiments with the Eurovision cross-language image retrieval system. J. Assoc. Inf. Sci. Technol. 57(5): 697-708 (2006)
[j13]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/PetrelliLBS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/PetrelliLBS06
Daniela Petrelli, Stephen Levin, Micheline Beaulieu, Mark Sanderson:
Which user interaction for cross-language information retrieval? Design issues and reflections. J. Assoc. Inf. Sci. Technol. 57(5): 709-722 (2006)
[j12]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CloughSR06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CloughSR06
Paul D. Clough, Mark Sanderson, Norman Reid:
The Eurovision St Andrews collection of photographs. SIGIR Forum 40(1): 21-30 (2006)
[j11]
- view
  authority control:
- export record
  dblp key:
  - journals/urban/ArampatzisKRJVCJS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/urban/ArampatzisKRJVCJS06
Avi Arampatzis, Marc J. van Kreveld, Iris Reinbacher, Christopher B. Jones, Subodh Vaid, Paul D. Clough, Hideo Joho, Mark Sanderson:
Web-based delineation of imprecise regions. Comput. Environ. Urban Syst. 30(4): 436-459 (2006)
[c57]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/GeyLSBMWSRNF06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/GeyLSBMWSRNF06
Fredric C. Gey, Ray R. Larson, Mark Sanderson, Kerstin Bischoff, Thomas Mandl, Christa Womser-Hacker, Diana Santos, Paulo Rocha, Giorgio Maria Di Nunzio, Nicola Ferro:
GeoCLEF 2006: The CLEF 2006 Cross-Language Geographic Information Retrieval Track Overview. CLEF 2006: 852-876
[c56]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/GeyLSBMWSRNF06a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/GeyLSBMWSRNF06a
Fredric C. Gey, Ray R. Larson, Mark Sanderson, Kerstin Bischoff, Thomas Mandl, Christa Womser-Hacker, Diana Santos, Paulo Rocha, Giorgio Maria Di Nunzio, Nicola Ferro:
GeoCLEF 2006: the CLEF 2006 Cross-Language Geographic Information Retrieval Track Overview. CLEF (Working Notes) 2006
[c55]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/AlberairS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/AlberairS06
Asaad Alberair, Mark Sanderson:
Morphological Variation of Arabic Queries. ECIR 2006: 468-471
[c54]
- view
  - electronic edition @ uni-hildesheim.de (archived)
  - details & citations
- export record
  dblp key:
  - conf/lwa/ShouS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lwa/ShouS06
Xiao Mang Shou, Mark Sanderson:
Initial Observations on Query Based Sampling in Distributed CLIR. LWA 2006: 68-68
[c53]
- view
  - electronic edition @ uni-hildesheim.de (archived)
  - details & citations
- export record
  dblp key:
  - conf/lwa/Al-MaskariCS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lwa/Al-MaskariCS06
Azzah Al-Maskari, Paul D. Clough, Mark Sanderson:
Users' Effectiveness and Satisfaction for Image Retrieval. LWA 2006: 84-88
[c52]
- view
  - electronic edition @ uni-hildesheim.de (archived)
  - details & citations
- export record
  dblp key:
  - conf/lwa/Al-MaskariS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lwa/Al-MaskariS06
Azzah Al-Maskari, Mark Sanderson:
The Effects of Topic Familiarity on User Search Behavior in Question Answering Systems. LWA 2006: 132-137
[e4]
- view
- export record
  dblp key:
  - conf/naacl/2006
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/2006
Robert C. Moore, Jeff A. Bilmes, Jennifer Chu-Carroll, Mark Sanderson:
Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 4-9, 2006, New York, New York, USA. The Association for Computational Linguistics 2006 [contents]
[e3]
- view
  authority control:
- export record
  dblp key:
  - conf/spire/2006
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/spire/2006
Fabio Crestani, Paolo Ferragina, Mark Sanderson:
String Processing and Information Retrieval, 13th International Conference, SPIRE 2006, Glasgow, UK, October 11-13, 2006, Proceedings. Lecture Notes in Computer Science 4209, Springer 2006, ISBN 3-540-45774-7 [contents]
2005
[c51]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/GeyLSJC05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/GeyLSJC05
Fredric C. Gey, Ray R. Larson, Mark Sanderson, Hideo Joho, Paul D. Clough:
GeoCLEF: the CLEF 2005 Cross-Language Geographic Information Retrieval Track. CLEF (Working Notes) 2005
[c50]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/GeyLSJCP05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/GeyLSJCP05
Fredric C. Gey, Ray R. Larson, Mark Sanderson, Hideo Joho, Paul D. Clough, Vivien Petras:
GeoCLEF: The CLEF 2005 Cross-Language Geographic Information Retrieval Track Overview. CLEF 2005: 908-919
[c49]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonZ05
Mark Sanderson, Justin Zobel:
Information retrieval system evaluation: effort, sensitivity, and reliability. SIGIR 2005: 162-169
[c48]
- view
  authority control:
- export record
  dblp key:
  - conf/ssd/VaidJJS05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ssd/VaidJJS05
Subodh Vaid, Christopher B. Jones, Hideo Joho, Mark Sanderson:
Spatio-textual Indexing for Geographical Search on the Web. SSTD 2005: 218-235
2004
[j10]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/OardGSLW04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/OardGSLW04
Douglas W. Oard, Julio Gonzalo, Mark Sanderson, Fernando López-Ostenero, Jianqiang Wang:
Interactive Cross-Language Document Selection. Inf. Retr. 7(1-2): 205-228 (2004)
[j9]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/PetrelliBSDHH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/PetrelliBSDHH04
Daniela Petrelli, Micheline Beaulieu, Mark Sanderson, George Demetriou, Patrick Herring, Preben Hansen:
Observing users, designing clarity: A case study on the user-centered design of a cross-language information retrieval system. J. Assoc. Inf. Sci. Technol. 55(10): 923-934 (2004)
[j8]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/JohoS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/JohoS04
Hideo Joho, Mark Sanderson:
The SPIRIT collection: an overview of a large web collection. SIGIR Forum 38(2): 57-61 (2004)
[c47]
- view
  authority control:
- export record
  dblp key:
  - conf/civr/CloughSM04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/civr/CloughSM04
Paul D. Clough, Mark Sanderson, Henning Müller:
The CLEF Cross Language Image Retrieval Track (ImageCLEF) 2004. CIVR 2004: 243-251
[c46]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/CloughMS05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/CloughMS05
Paul D. Clough, Henning Müller, Mark Sanderson:
The CLEF 2004 Cross-Language Image Retrieval Track. CLEF 2004: 597-613
[c45]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/CloughSM04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/CloughSM04
Paul D. Clough, Mark Sanderson, Henning Müller:
The CLEF Cross Language Image Retrieval Track (ImageCLEF) 2004. CLEF (Working Notes) 2004
[c44]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/JohoSB04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/JohoSB04
Hideo Joho, Mark Sanderson, Micheline Beaulieu:
A Study of User Interaction with a Concept-Based Interactive Query Expansion Support Tool. ECIR 2004: 42-56
[c43]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/CloughS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/CloughS04
Paul D. Clough, Mark Sanderson:
Relevance Feedback for Cross Language Image Retrieval. ECIR 2004: 238-252
[c42]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SandersonCPL04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SandersonCPL04
Mark Sanderson, Paul D. Clough, Catherine Paterson, Wai Tung Lo:
Measuring a Cross Language Image Retrieval System. ECIR 2004: 353-363
[c41]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/iadis/HedleyYJS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iadis/HedleyYJS04
Yih-Ling Hedley, Muhammad Younas, Anne E. James, Mark Sanderson:
Information Extraction from Template-Generated Hidden Web Documents. ICWI 2004: 627-634
[c40]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonJ04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonJ04
Mark Sanderson, Hideo Joho:
Forming test collections with no system pooling. SIGIR 2004: 33-40
[c39]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonP04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonP04
Mark Sanderson, Robert C. Pasley:
Image based gisting in CLIR. SIGIR 2004: 466-467
[c38]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/CloughS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/CloughS04
Paul D. Clough, Mark Sanderson:
Measuring pseudo relevance feedback & CLIR. SIGIR 2004: 484-485
[c37]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/HedleyYJS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/HedleyYJS04
Yih-Ling Hedley, Muhammad Younas, Anne E. James, Mark Sanderson:
Query-related data extraction of hidden web documents. SIGIR 2004: 558-559
[c36]
- view
  authority control:
- export record
  dblp key:
  - conf/widm/HedleyYJS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/widm/HedleyYJS04
Yih-Ling Hedley, Muhammad Younas, Anne E. James, Mark Sanderson:
A two-phase sampling technique for information extraction from hidden web databases. WIDM 2004: 1-8
[c35]
- view
  authority control:
- export record
  dblp key:
  - conf/wise/HedleyYJS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wise/HedleyYJS04
Yih-Ling Hedley, Muhammad Younas, Anne E. James, Mark Sanderson:
A Two-Phase Sampling Technique to Improve the Accuracy of Text Similarities in the Categorisation of Hidden Web Databases. WISE 2004: 516-527
[e2]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/2003dmir
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/2003dmir
James P. Callan, Fabio Crestani, Mark Sanderson:
Distributed Multimedia Information Retrieval, SIGIR 2003 Workshop on Distributed Information Retrieval, Toronto, Canada, August 1, 2003, Revised Selected and Invited Papers. Lecture Notes in Computer Science 2924, Springer 2004, ISBN 3-540-20875-5 [contents]
[e1]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/2004
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/2004
Mark Sanderson, Kalervo Järvelin, James Allan, Peter Bruza:
SIGIR 2004: Proceedings of the 27th Annual International ACM SIGIR Conference on Research and Development in Information Retrieval, Sheffield, UK, July 25-29, 2004. ACM 2004, ISBN 1-58113-881-4 [contents]
2003
[j7]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
James Allan, Jay Aslam, Nicholas J. Belkin, Chris Buckley, James P. Callan, W. Bruce Croft, Susan T. Dumais, Norbert Fuhr, Donna Harman, David J. Harper, Djoerd Hiemstra, Thomas Hofmann, Eduard H. Hovy, Wessel Kraaij, John D. Lafferty, Victor Lavrenko, David D. Lewis, Liz Liddy, R. Manmatha, Andrew McCallum, Jay M. Ponte, John M. Prager, Dragomir R. Radev, Philip Resnik, Stephen E. Robertson, Ronald Rosenfeld, Salim Roukos, Mark Sanderson, Richard M. Schwartz, Amit Singhal, Alan F. Smeaton, Howard R. Turtle, Ellen M. Voorhees, Ralph M. Weischedel, Jinxi Xu, ChengXiang Zhai:
Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002. SIGIR Forum 37(1): 31-47 (2003)
[j6]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CallanCS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CallanCS03
Jamie Callan, Fabio Crestani, Mark Sanderson:
SIGIR 2003 workshop on distributed information retrieval. SIGIR Forum 37(2): 33-37 (2003)
[c34]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/BallesterosS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/BallesterosS03
Lisa Ballesteros, Mark Sanderson:
Addressing the lack of direct translation resources for cross-language retrieval. CIKM 2003: 147-152
[c33]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/CloughS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/CloughS03
Paul D. Clough, Mark Sanderson:
The CLEF 2003 Cross Language Image Retrieval Track. CLEF 2003: 581-593
[c32]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/CloughS03a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/CloughS03a
Paul D. Clough, Mark Sanderson:
Assessing Translation Quality for Cross Language Image Retrieval. CLEF 2003: 594-610
[c31]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/CloughS03b
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/CloughS03b
Paul D. Clough, Mark Sanderson:
The CLEF 2003 Cross Language Image Retrieval Task. CLEF (Working Notes) 2003
[c30]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/CloughS03c
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/CloughS03c
Paul D. Clough, Mark Sanderson:
Sheffield at ImageCLEF 2003. CLEF (Working Notes) 2003
[c29]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LevinCS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LevinCS03
Stephen Levin, Paul D. Clough, Mark Sanderson:
Assessing the effectiveness of pen-based input queries. SIGIR 2003: 437-438
2002
[c28]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/PetrelliDHBS02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PetrelliDHBS02
Daniela Petrelli, George Demetriou, Patrick Herring, Micheline Beaulieu, Mark Sanderson:
Exploring the Effect of Query Translation when Searching Cross-Language. CLEF 2002: 430-445
[c27]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/PetrelliDHBS02a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PetrelliDHBS02a
Daniela Petrelli, George Demetriou, Patrick Herring, Micheline Beaulieu, Mark Sanderson:
Is Query Translation a Distinct Task from Search? CLEF (Working Notes) 2002
[c26]
- view
  authority control:
- export record
  dblp key:
  - conf/sac/JohoCSB02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sac/JohoCSB02
Hideo Joho, Claire Coverson, Mark Sanderson, Micheline Hancock-Beaulieu:
Hierarchical presentation of expansion terms. SAC 2002: 645-649
[c25]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/HansenPKBS02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/HansenPKBS02
Preben Hansen, Daniela Petrelli, Jussi Karlgren, Micheline Beaulieu, Mark Sanderson:
User-centered interface design for cross-language information retrieval. SIGIR 2002: 383-384
[c24]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JonesPRSSKW02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JonesPRSSKW02
Christopher B. Jones, Ross Purves, Anne Ruas, Mark Sanderson, Monika Sester, Marc J. van Kreveld, Robert Weibel:
Spatial information retrieval and geographical ontologies an overview of the SPIRIT project. SIGIR 2002: 387-388
[c23]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShouS02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShouS02
Xiao Mang Shou, Mark Sanderson:
Experiments on data fusion using headline information. SIGIR 2002: 413-414
[c22]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/JohoSB02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/JohoSB02
Hideo Joho, Mark Sanderson, Micheline Beaulieu:
Hierarchical approach to term suggestion device. SIGIR 2002: 454
2001
[c21]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/BathieS01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/BathieS01
Zoë Bathie, Mark Sanderson:
iCLEF at Sheffield. CLEF (Working Notes) 2001
[c20]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/SandersonB01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/SandersonB01
Mark Sanderson, Zoë Bathie:
iCLEF at Sheffield. CLEF 2001: 332-335
[c19]
- view
  - electronic edition @ aclanthology.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/naacl/JohoLS01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/JohoLS01
Hideo Joho, Ying Ki Liu, Mark Sanderson:
Large scale testing of a descriptive phrase finder. HLT 2001
[c18]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonS01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonS01
Mark Sanderson, Xiao Mang Shou:
Speech and Hand Transcribed Retrieval. SIGIR Workshop: Information Retrieval Techniques for Speech Applications 2001: 78-85
[c17]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/GollinsS01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/GollinsS01
Tim Gollins, Mark Sanderson:
Improving Cross Language Information Retrieval with Triangulated Translation. SIGIR 2001: 90-95
[c16]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/SandersonA01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/SandersonA01
Mark Sanderson, Asaad Alberair:
Keep It Simple Sheffield - A KISS Approach to the Arabic Track. TREC 2001
2000
[j5]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/Sanderson00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/Sanderson00
Mark Sanderson:
Retrieving with Good Sense. Inf. Retr. 2(1): 45-65 (2000)
[c15]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/JohoS00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/JohoS00
Hideo Joho, Mark Sanderson:
Retrieving Descriptive Phrases from Large Amounts of Free Text. CIKM 2000: 180-186
[c14]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/GollinsS00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/GollinsS00
Tim Gollins, Mark Sanderson:
Sheffield University CLEF 2000 Submission - Bilingual Track: German to English. CLEF 2000: 245-252
[c13]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/GollinsS00a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/GollinsS00a
Tim Gollins, Mark Sanderson:
Sheffield University: CLEF 2000 Submission (Bilingual Track - German to English). CLEF (Working Notes) 2000

1990 – 1999

see FAQ

What is the meaning of the colors in the publication lists?

1999
[j4]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/SandersonR99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/SandersonR99
Mark Sanderson, C. J. van Rijsbergen:
The impact on retrieval effectiveness of skewed frequency distributions. ACM Trans. Inf. Syst. 17(4): 440-465 (1999)
[c12]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SandersonC99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SandersonC99
Mark Sanderson, W. Bruce Croft:
Deriving Concept Hierarchies from Text. SIGIR 1999: 206-213
[c11]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/Hancock-BeaulieuFAS99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Hancock-BeaulieuFAS99
Micheline Hancock-Beaulieu, Helene Fowkes, Nega Alemayehu, Mark Sanderson:
Interactive Okapi at Sheffield - TREC-8. TREC 1999
[c10]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/HumphreysGHS99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/HumphreysGHS99
Kevin Humphreys, Robert J. Gaizauskas, Mark Hepple, Mark Sanderson:
University of Sheffield TREC-8 Q&A System. TREC 1999
1998
[j3]
- view
  authority control:
- export record
  dblp key:
  - journals/jd/PurvesS98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jd/PurvesS98
Ross S. Purves, Mark Sanderson:
A methodology to allow avalanche forecasting on an information retrieval system. J. Documentation 54(2): 198-209 (1998)
[c9]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/Sanderson98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/Sanderson98
Mark Sanderson:
Accurate User Directed Summarizatiion from Existing Tools. CIKM 1998: 45-51
[c8]
- view
  authority control:
- export record
  dblp key:
  - conf/ercimdl/SandersonC98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ercimdl/SandersonC98
Mark Sanderson, Fabio Crestani:
Mixing and Merging for Spoken Document Retrieval. ECDL 1998: 397-407
[c7]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TombrosS98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TombrosS98
Anastasios Tombros, Mark Sanderson:
Advantages of Query Biased Summaries in Information Retrieval. SIGIR 1998: 2-10
[c6]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/trec/AllanCSXW98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/AllanCSXW98
James Allan, James P. Callan, Mark Sanderson, Jinxi Xu, Steven Wegmann:
INQUERY and TREC-7. TREC 1998: 148-163
1997
[j2]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/Sanderson97
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/Sanderson97
Mark Sanderson:
Information Seeking in Electronic Environment. Inf. Process. Manag. 33(1): 126 (1997)
[c5]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/HarmandasSD97
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/HarmandasSD97
V. Harmandas, Mark Sanderson, Mark D. Dunlop:
Image Retrieval by Hypertext Links. SIGIR 1997: 296-303
[c4]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/CrestaniSTL97
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/CrestaniSTL97
Fabio Crestani, Mark Sanderson, Marcos Theophylactou, Mounia Lalmas:
Short Queries, Natural Language and Spoken Document Retrieval: Experiments at Glasgow University. TREC 1997: 667-686
1996
[b1]
- view
- export record
  dblp key:
  - phd/ethos/Sanderson96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/phd/ethos/Sanderson96
Mark Sanderson:
Word sense disambiguation and information retrieval. University of Glasgow, UK, 1996
[c3]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/SandersonR96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/SandersonR96
Mark Sanderson, Ian Ruthven:
Report on the Glasgow IR group (glair4) submission. TREC 1996
1995
[c2]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/CrestaniRSR95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/CrestaniRSR95
Fabio Crestani, Ian Ruthven, Mark Sanderson, C. J. van Rijsbergen:
The Troubles with Using a Logical Model of IR on a Large Collection of Documents. TREC 1995
1994
[c1]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Sanderson94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Sanderson94
Mark Sanderson:
Word Sense Disambiguation and Information Retrieval. SIGIR 1994: 142-151
1991
[j1]
- no documents available
  - details & citations
- export record
  dblp key:
  - journals/epodd/SandersonR91
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/epodd/SandersonR91
Mark Sanderson, C. J. van Rijsbergen:
NRT: News Retrieval Tool. Electron. Publ. 4(4): 205-217 (1991)

Coauthor Index

see FAQ

manage site settings

To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.