default search action

combined dblp search
author search
venue search
publication search

ask others

Susan T. Dumais

> Home > Persons

Person information

affiliation: Microsoft Research
award: ACM Athena Lecturer 2014

Refine list

refinements active!

zoomed in on ?? of ?? records

view refined list in

export refined list as

showing all ?? records

2020 – today

see FAQ

What is the meaning of the colors in the publication lists?

2021
[j39]
- view
  authority control:
- export record
  dblp key:
  - journals/expert/ShuDAL21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/expert/ShuDAL21
Kai Shu, Susan T. Dumais, Ahmed Hassan Awadallah, Huan Liu:
Detecting Fake News With Weak Social Supervision. IEEE Intell. Syst. 36(4): 96-103 (2021)
[c152]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/ZhengAD21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/ZhengAD21
Guoqing Zheng, Ahmed Hassan Awadallah, Susan T. Dumais:
Meta Label Correction for Noisy Label Learning. AAAI 2021: 11053-11061
[c151]
- view
  authority control:
- export record
  dblp key:
  - conf/recsys/YangSBD21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/recsys/YangSBD21
Longqi Yang, Tobias Schnabel, Paul N. Bennett, Susan T. Dumais:
Local Factor Models for Large-Scale Inductive Recommendation. RecSys 2021: 252-262
[c150]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/Dumais21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/Dumais21
Susan T. Dumais:
Beyond Web Search: How Email Search is Different and Why it Matters. WSDM 2021: 2
2020
[j38]
- view
  authority control:
- export record
  dblp key:
  - journals/pacmhci/ZhangPDH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/pacmhci/ZhangPDH20
Justine Zhang, James W. Pennebaker, Susan T. Dumais, Eric Horvitz:
Configuring Audiences: A Case Study of Email Communication. Proc. ACM Hum. Comput. Interact. 4(CSCW): 062:1-062:26 (2020)
[c149]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/Dumais20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/Dumais20
Susan T. Dumais:
SIGCHI Lifetime Research Award Talk: Interdisciplinary Perspectives on Search. CHI Extended Abstracts 2020: 1-3
[c148]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/JahanbakhshADX20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/JahanbakhshADX20
Farnaz Jahanbakhsh, Ahmed Hassan Awadallah, Susan T. Dumais, Xuhai Xu:
Effects of Past Interactions on User Experience with Recommended Documents. CHIIR 2020: 153-162
[c147]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ShuMZASD20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ShuMZASD20
Kai Shu, Subhabrata Mukherjee, Guoqing Zheng, Ahmed Hassan Awadallah, Milad Shokouhi, Susan T. Dumais:
Learning with Weak Supervision for Email Intent Detection. SIGIR 2020: 1051-1060
[c146]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZamaniMCLDBCD20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZamaniMCLDBCD20
Hamed Zamani, Bhaskar Mitra, Everest Chen, Gord Lueck, Fernando Diaz, Paul N. Bennett, Nick Craswell, Susan T. Dumais:
Analyzing and Learning from User Interactions for Search Clarification. SIGIR 2020: 1181-1190
[c145]
- view
  authority control:
- export record
  dblp key:
  - conf/www/ZamaniDCBL20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/ZamaniDCBL20
Hamed Zamani, Susan T. Dumais, Nick Craswell, Paul N. Bennett, Gord Lueck:
Generating Clarifying Questions for Information Retrieval. WWW 2020: 418-428
[c144]
- view
  authority control:
- export record
  dblp key:
  - conf/www/XuADOPRJ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/XuADOPRJ20
Xuhai Xu, Ahmed Hassan Awadallah, Susan T. Dumais, Farheen Omar, Bogdan Popp, Robert Rounthwaite, Farnaz Jahanbakhsh:
Understanding User Behavior For Document Recommendation. WWW 2020: 3012-3018
[i10]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2001-00802
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2001-00802
Xinyi Li, Chia-Jung Lee, Milad Shokouhi, Susan T. Dumais:
Characterizing Reading Time on Enterprise Emails. CoRR abs/2001.00802 (2020)
[i9]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2005-13084
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2005-13084
Kai Shu, Subhabrata Mukherjee, Guoqing Zheng, Ahmed Hassan Awadallah, Milad Shokouhi, Susan T. Dumais:
Learning with Weak Supervision for Email Intent Detection. CoRR abs/2005.13084 (2020)
[i8]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2006-00166
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2006-00166
Hamed Zamani, Bhaskar Mitra, Everest Chen, Gord Lueck, Fernando Diaz, Paul N. Bennett, Nick Craswell, Susan T. Dumais:
Analyzing and Learning from User Interactions for Search Clarification. CoRR abs/2006.00166 (2020)

2010 – 2019

see FAQ

What is the meaning of the colors in the publication lists?

2019
[c143]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/SarrafzadehALLS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/SarrafzadehALLS19
Bahareh Sarrafzadeh, Ahmed Hassan Awadallah, Christopher H. Lin, Chia-Jung Lee, Milad Shokouhi, Susan T. Dumais:
Characterizing and Predicting Email Deferral Behavior. WSDM 2019: 627-635
[c142]
- view
  authority control:
- export record
  dblp key:
  - conf/www/AlrashedLBLSD19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/AlrashedLBLSD19
Tarfah Alrashed, Chia-Jung Lee, Peter Bailey, Christopher H. Lin, Milad Shokouhi, Susan T. Dumais:
Evaluating User Actions as a Proxy for Email Significance. WWW 2019: 26-36
[i7]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1901-04375
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1901-04375
Bahareh Sarrafzadeh, Ahmed Hassan Awadallah, Christopher H. Lin, Chia-Jung Lee, Milad Shokouhi, Susan T. Dumais:
Characterizing and Predicting Email Deferral Behavior. CoRR abs/1901.04375 (2019)
[i6]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1910-11430
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1910-11430
Kai Shu, Ahmed Hassan Awadallah, Susan T. Dumais, Huan Liu:
Detecting Fake News with Weak Social Supervision. CoRR abs/1910.11430 (2019)
[i5]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1911-03809
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1911-03809
Guoqing Zheng, Ahmed Hassan Awadallah, Susan T. Dumais:
Meta Label Correction for Learning with Weak Supervision. CoRR abs/1911.03809 (2019)
2018
[j37]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AgichteinBD18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AgichteinBD18
Eugene Agichtein, Eric Brill, Susan T. Dumais:
Improving Web Search Ranking by Incorporating User Behavior Information. SIGIR Forum 52(2): 11-18 (2018)
[c141]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/AlrashedAD18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/AlrashedAD18
Tarfah Alrashed, Ahmed Hassan Awadallah, Susan T. Dumais:
The Lifetime of Email Messages: A Large-Scale Analysis of Email Revisitation. CHIIR 2018: 120-129
[c140]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/BotaFDRR18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/BotaFDRR18
Horatiu S. Bota, Adam Fourney, Susan T. Dumais, Tomasz L. Religa, Robert Rounthwaite:
Characterizing Search Behavior in Productivity Software. CHIIR 2018: 160-169
[c139]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/Dumais18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/Dumais18
Susan T. Dumais:
Better Together: An Interdisciplinary Perspective on Information Retrieval. CHIIR 2018: 170
[c138]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ZhaoBFTWTD18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ZhaoBFTWTD18
Qian Zhao, Paul N. Bennett, Adam Fourney, Anne Loomis Thompson, Shane Williams, Adam D. Troy, Susan T. Dumais:
Calendar-Aware Proactive Email Recommendation. SIGIR 2018: 655-664
[c137]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/SchnabelBDJ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/SchnabelBDJ18
Tobias Schnabel, Paul N. Bennett, Susan T. Dumais, Thorsten Joachims:
Short-Term Satisfaction and Long-Term Coverage: Understanding How Users Tolerate Algorithmic Exploration. WSDM 2018: 513-521
[r2]
- view
  authority control:
- export record
  dblp key:
  - reference/db/Dumais18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/db/Dumais18
Susan T. Dumais:
Faceted Search. Encyclopedia of Database Systems (2nd ed.) 2018
2017
[j36]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AllanBBCCDDFHHR17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AllanBBCCDDFHHR17
James Allan, Nicholas J. Belkin, Paul N. Bennett, Jamie Callan, Charles L. A. Clarke, Fernando Diaz, Susan T. Dumais, Nicola Ferro, Donna Harman, Djoerd Hiemstra, Ian Ruthven, Tetsuya Sakai, Mark D. Smucker, Justin Zobel:
Overview of Special Issue. SIGIR Forum 51(2): 1-25 (2017)
[j35]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/FurnasDDLHSL17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/FurnasDDLHSL17
George W. Furnas, Scott C. Deerwester, Susan T. Dumais, Thomas K. Landauer, Richard A. Harshman, Lynn A. Streeter, Karen E. Lochbaum:
Information Retrieval using a Singular Value Decomposition Model of Latent Semantic Structure. SIGIR Forum 51(2): 90-105 (2017)
[j34]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/TeevanDH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/TeevanDH17
Jaime Teevan, Susan T. Dumais, Eric Horvitz:
Personalizing Search via Automated Analysis of Interests and Activities. SIGIR Forum 51(3): 10-17 (2017)
[c136]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/BotaBAD17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/BotaBAD17
Horatiu S. Bota, Paul N. Bennett, Ahmed Hassan Awadallah, Susan T. Dumais:
Self-Es: The Role of Emails-to-Self in Personal Information Management. CHIIR 2017: 205-214
[c135]
- view
  authority control:
- export record
  dblp key:
  - conf/chiir/NarangDCLA17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chiir/NarangDCLA17
Kanika Narang, Susan T. Dumais, Nick Craswell, Daniel J. Liebling, Qingyao Ai:
Large-Scale Analysis of Email Search and Organizational Strategies. CHIIR 2017: 215-223
[c134]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/0019DBA17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/0019DBA17
Liu Yang, Susan T. Dumais, Paul N. Bennett, Ahmed Hassan Awadallah:
Characterizing and Predicting Enterprise Email Reply Behavior. SIGIR 2017: 235-244
[c133]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/0005CDRL17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/0005CDRL17
Jin Young Kim, Nick Craswell, Susan T. Dumais, Filip Radlinski, Fang Liu:
Understanding and Modeling Success in Email Search. SIGIR 2017: 265-274
[c132]
- view
  authority control:
- export record
  dblp key:
  - conf/www/AiDCL17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/AiDCL17
Qingyao Ai, Susan T. Dumais, Nick Craswell, Daniel J. Liebling:
Characterizing Email Search using Large-scale Behavioral Logs and Surveys. WWW 2017: 1511-1520
2016
[c131]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/Dumais16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/Dumais16
Susan T. Dumais:
Personalized Search: Potential and Pitfalls. CIKM 2016: 689
[c130]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FourneyD16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FourneyD16
Adam Fourney, Susan T. Dumais:
Automatic Identification and Contextual Reformulation of Implicit System-Related Queries. SIGIR 2016: 761-764
[c129]
- view
  authority control:
- export record
  dblp key:
  - conf/www/SchnabelBDJ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/SchnabelBDJ16
Tobias Schnabel, Paul N. Bennett, Susan T. Dumais, Thorsten Joachims:
Using Shortlists to Support Decision Making and Improve Recommender System Performance. WWW 2016: 987-997
2015
[j33]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/DumaisCCJSR15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/DumaisCCJSR15
Susan T. Dumais, Edward Cutrell, Jonathan J. Cadiz, Gavin Jancke, Raman Sarin, Daniel C. Robbins:
Stuff I've Seen: A System for Personal Information Retrieval and Re-Use. SIGIR Forum 49(2): 28-35 (2015)
[c128]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/Dumais15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/Dumais15
Susan T. Dumais:
ACM-W Athena Lecture - Large-Scale Behavioral Data: Potential and Pitfalls. CHI Extended Abstracts 2015: 809-811
[c127]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/OdijkWAD15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/OdijkWAD15
Daan Odijk, Ryen W. White, Ahmed Hassan Awadallah, Susan T. Dumais:
Struggling and Success in Web Search. CIKM 2015: 1551-1560
[c126]
- view
  - electronic edition @ usenix.org
  - details & citations
- export record
  dblp key:
  - conf/hotos/WangMGIBKMCTTCD15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/hotos/WangMGIBKMCTTCD15
Helen J. Wang, Alexander Moshchuk, Michael Gamon, Shamsi T. Iqbal, Eli T. Brown, Ashish Kapoor, Christopher Meek, Eric Yawei Chen, Yuan Tian, Jaime Teevan, Mary Czerwinski, Susan T. Dumais:
The Activity Platform. HotOS 2015
[c125]
- view
  authority control:
- export record
  dblp key:
  - conf/huc/TurnerID15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/huc/TurnerID15
Jayson Turner, Shamsi T. Iqbal, Susan T. Dumais:
Understanding gaze and scrolling strategies in text consumption tasks. UbiComp/ISWC Adjunct 2015: 829-838
[c124]
- view
  - electronic edition @ computationalcreativity.net (open access)
  - details & citations
- export record
  dblp key:
  - conf/icccrea/WenBTTDK15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icccrea/WenBTTDK15
Miaomiao Wen, Nancy Baym, Omer Tamuz, Jaime Teevan, Susan T. Dumais, Adam Kalai:
OMG UR Funny! Computer-Aided Humor with an Application to Chat. ICCC 2015: 86-93
[c123]
- view
  - electronic edition @ ijcai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/ijcai/OrganisciakTDMK15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/OrganisciakTDMK15
Peter Organisciak, Jaime Teevan, Susan T. Dumais, Robert C. Miller, Adam Tauman Kalai:
Matching and Grokking: Approaches to Personalized Crowdsourcing. IJCAI 2015: 4296-4302
[i4]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/SchnabelBDJ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/SchnabelBDJ15
Tobias Schnabel, Paul N. Bennett, Susan T. Dumais, Thorsten Joachims:
Using Shortlists to Support Decision Making and Improve Recommender System Performance. CoRR abs/1510.07545 (2015)
2014
[j32]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/TeevanCWD14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/TeevanCWD14
Jaime Teevan, Kevyn Collins-Thompson, Ryen W. White, Susan T. Dumais:
Slow search. Commun. ACM 57(8): 36-38 (2014)
[c122]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/AwadallahWPDW14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/AwadallahWPDW14
Ahmed Hassan Awadallah, Ryen W. White, Patrick Pantel, Susan T. Dumais, Yi-Min Wang:
Supporting Complex Search Tasks. CIKM 2014: 829-838
[c121]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/hcomp/OrganisciakTDMK14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/hcomp/OrganisciakTDMK14
Peter Organisciak, Jaime Teevan, Susan T. Dumais, Robert C. Miller, Adam Tauman Kalai:
A Crowd of Your Own: Crowdsourcing for On-Demand Personalization. HCOMP 2014: 192-200
[c120]
- view
  authority control:
- export record
  dblp key:
  - conf/huc/LieblingD14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/huc/LieblingD14
Daniel J. Liebling, Susan T. Dumais:
Gaze and mouse coordination in everyday work. UbiComp Adjunct 2014: 1141-1150
[c119]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - conf/ntcir/Dumais14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ntcir/Dumais14
Susan T. Dumais:
Personalized Search: Potential and Pitfalls. NTCIR 2014
[c118]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Dumais14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Dumais14
Susan T. Dumais:
Putting searchers into search. SIGIR 2014: 1-2
[c117]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LivneGTDA14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LivneGTDA14
Avishay Livne, Vivek Gokuladas, Jaime Teevan, Susan T. Dumais, Eytan Adar:
CiteSight: supporting contextual citation recommendation using differential search. SIGIR 2014: 807-816
[c116]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/HassanWDW14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/HassanWDW14
Ahmed Hassan Awadallah, Ryen W. White, Susan T. Dumais, Yi-Min Wang:
Struggling or exploring?: disambiguating long search sessions. WSDM 2014: 53-62
[c115]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/EickhoffTWD14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/EickhoffTWD14
Carsten Eickhoff, Jaime Teevan, Ryen White, Susan T. Dumais:
Lessons from the journey: a query log analysis of within-session learning. WSDM 2014: 223-232
[p2]
- view
  authority control:
- export record
  dblp key:
  - books/sp/14/DumaisJRTT14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/14/DumaisJRTT14
Susan T. Dumais, Robin Jeffries, Daniel M. Russell, Diane Tang, Jaime Teevan:
Understanding User Behavior Through Log Data and Analysis. Ways of Knowing in HCI 2014: 349-372
2013
[j31]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/RadinskySDSTBH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/RadinskySDSTBH13
Kira Radinsky, Krysta M. Svore, Susan T. Dumais, Milad Shokouhi, Jaime Teevan, Alex Bocharov, Eric Horvitz:
Behavioral dynamics on the web: Learning, modeling, and prediction. ACM Trans. Inf. Syst. 31(3): 16 (2013)
[c114]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/KatoWTD13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/KatoWTD13
Makoto P. Kato, Ryen W. White, Jaime Teevan, Susan T. Dumais:
Clarifications and question specificity in synchronous social Q&A. CHI Extended Abstracts 2013: 913-918
[c113]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/EickhoffCBD13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/EickhoffCBD13
Carsten Eickhoff, Kevyn Collins-Thompson, Paul N. Bennett, Susan T. Dumais:
Designing Human-Readable User Profiles for Search Evaluation. ECIR 2013: 701-705
[c112]
- view
  authority control:
- export record
  dblp key:
  - conf/hcir/TeevanCWDK13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/hcir/TeevanCWDK13
Jaime Teevan, Kevyn Collins-Thompson, Ryen W. White, Susan T. Dumais, Yubin Kim:
Slow Search: Information Retrieval without Time Constraints. HCIR 2013: 1:1-1:10
[c111]
- view
  - electronic edition @ aaai.org (archived)
  - details & citations
- export record
  dblp key:
  - conf/hcomp/OrganisciakTDMK13a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/hcomp/OrganisciakTDMK13a
Peter Organisciak, Jaime Teevan, Susan T. Dumais, Robert C. Miller, Adam Tauman Kalai:
Personalized Human Computation. HCOMP (Works in Progress / Demos) 2013
[c110]
- view
  - electronic edition @ aaai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/icwsm/KairamMTLD13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/KairamMTLD13
Sanjay Ram Kairam, Meredith Ringel Morris, Jaime Teevan, Daniel J. Liebling, Susan T. Dumais:
Towards Supporting Search over Trending Events with Social Media. ICWSM 2013
[c109]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DiazDERRS13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DiazDERRS13
Fernando Diaz, Susan T. Dumais, Miles Efron, Kira Radinsky, Maarten de Rijke, Milad Shokouhi:
SIGIR 2013 workshop on time aware information access (#TAIA2013). SIGIR 2013: 1137
[c108]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/EickhoffCBD13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/EickhoffCBD13
Carsten Eickhoff, Kevyn Collins-Thompson, Paul N. Bennett, Susan T. Dumais:
Personalizing atypical web search sessions. WSDM 2013: 285-294
[c107]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/RadinskyDDSDC13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/RadinskyDDSDC13
Kira Radinsky, Fernando Diaz, Susan T. Dumais, Milad Shokouhi, Anlei Dong, Yi Chang:
Temporal web dynamics and its application to information retrieval. WSDM 2013: 781-782
2012
[j30]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/DiazDRRS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/DiazDRRS12
Fernando Diaz, Susan T. Dumais, Kira Radinsky, Maarten de Rijke, Milad Shokouhi:
#TAIA2012. SIGIR Forum 46(2): 102-106 (2012)
[j29]
- view
  authority control:
- export record
  dblp key:
  - journals/tvcg/DorkRRD12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tvcg/DorkRRD12
Marian Dörk, Nathalie Henry Riche, Gonzalo A. Ramos, Susan T. Dumais:
PivotPaths: Strolling through Faceted Information Spaces. IEEE Trans. Vis. Comput. Graph. 18(12): 2709-2718 (2012)
[c106]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/BernsteinTDLH12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/BernsteinTDLH12
Michael S. Bernstein, Jaime Teevan, Susan T. Dumais, Daniel J. Liebling, Eric Horvitz:
Direct answers for search queries in the long tail. CHI 2012: 237-246
[c105]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DiriyeWBD12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DiriyeWBD12
Abdigani Diriye, Ryen White, Georg Buscher, Susan T. Dumais:
Leaving so soon?: understanding and predicting web search abandonment rationales. CIKM 2012: 1025-1034
[c104]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/BennettWCDBBC12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/BennettWCDBBC12
Paul N. Bennett, Ryen W. White, Wei Chu, Susan T. Dumais, Peter Bailey, Fedor Borisyuk, Xiaoyuan Cui:
Modeling the impact of short- and long-term behavior on search personalization. SIGIR 2012: 185-194
[c103]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/AgichteinWDB12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/AgichteinWDB12
Eugene Agichtein, Ryen W. White, Susan T. Dumais, Paul N. Bennett:
Search, interrupted: understanding and predicting search task continuation. SIGIR 2012: 315-324
[c102]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Dumais12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Dumais12
Susan T. Dumais:
Putting context into search and search into context. SIGIR 2012: 1021
[c101]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/SvoreTDK12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/SvoreTDK12
Krysta M. Svore, Jaime Teevan, Susan T. Dumais, Anagha Kulkarni:
Creating temporally dynamic web search snippets. SIGIR 2012: 1045-1046
[c100]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/KimCBD12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/KimCBD12
Jin Young Kim, Kevyn Collins-Thompson, Paul N. Bennett, Susan T. Dumais:
Characterizing web content, user interests, and search behavior by reading level and topic. WSDM 2012: 213-222
[c99]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/BuscherWDH12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/BuscherWDH12
Georg Buscher, Ryen W. White, Susan T. Dumais, Jeff Huang:
Large-scale analysis of individual and task differences in search result page examination strategies. WSDM 2012: 373-382
[c98]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/SontagCBWDB12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/SontagCBWDB12
David A. Sontag, Kevyn Collins-Thompson, Paul N. Bennett, Ryen W. White, Susan T. Dumais, Bodo Billerbeck:
Probabilistic models for personalizing web search. WSDM 2012: 433-442
[c97]
- view
  authority control:
- export record
  dblp key:
  - conf/www/RadinskySDTBH12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/RadinskySDTBH12
Kira Radinsky, Krysta M. Svore, Susan T. Dumais, Jaime Teevan, Alex Bocharov, Eric Horvitz:
Modeling and predicting behavioral dynamics on the web. WWW 2012: 599-608
[i3]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1212-2453
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1212-2453
David Azari, Eric Horvitz, Susan T. Dumais, Eric Brill:
Web-Based Question Answering: A Decision-Making Perspective. CoRR abs/1212.2453 (2012)
[i2]
- view
  - electronic edition @ nii.ac.jp (open access)
  - details & citations
- export record
  dblp key:
  - journals/shonan-reports/BelkinDKS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/shonan-reports/BelkinDKS12
Nicholas J. Belkin, Susan T. Dumais, Noriko Kando, Mark Sanderson:
Whole-Session Evaluation of Interactive Information Retrieval Systems (NII Shonan Meeting 2012-7). NII Shonan Meet. Rep. 2012 (2012)
2011
[c96]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/HuangWD11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/HuangWD11
Jeff Huang, Ryen W. White, Susan T. Dumais:
No clicks, no problem: using cursor movements to understand and improve search. CHI 2011: 1225-1234
[c95]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/RamageMD11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/RamageMD11
Daniel Ramage, Christopher D. Manning, Susan T. Dumais:
Partially labeled topic models for interpretable text mining. KDD 2011: 457-465
[c94]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/KotovBWDT11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/KotovBWDT11
Alexander Kotov, Paul N. Bennett, Ryen W. White, Susan T. Dumais, Jaime Teevan:
Modeling and analysis of cross-session search tasks. SIGIR 2011: 5-14
[c93]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/GuoWZAD11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/GuoWZAD11
Qi Guo, Ryen W. White, Yunqiao Zhang, Blake Anderson, Susan T. Dumais:
Why searchers switch: understanding and predicting engine switching rationales. SIGIR 2011: 335-344
[c92]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/KulkarniTSD11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/KulkarniTSD11
Anagha Kulkarni, Jaime Teevan, Krysta M. Svore, Susan T. Dumais:
Understanding temporal query dynamics. WSDM 2011: 167-176
[c91]
- view
  authority control:
- export record
  dblp key:
  - conf/www/Danescu-Niculescu-MizilGD11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/Danescu-Niculescu-MizilGD11
Cristian Danescu-Niculescu-Mizil, Michael Gamon, Susan T. Dumais:
Mark my words!: linguistic style accommodation in social media. WWW 2011: 745-754
[p1]
- no documents available
  - details & citations
- export record
  dblp key:
  - books/others/11/TeevanD11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/others/11/TeevanD11
Jaime Teevan, Susan T. Dumais:
Web retrieval, ranking and personalization. Interactive Information Seeking, Behaviour and Retrieval 2011: 189-204
[i1]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1105-0673
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1105-0673
Cristian Danescu-Niculescu-Mizil, Michael Gamon, Susan T. Dumais:
Mark My Words! Linguistic Style Accommodation in Social Media. CoRR abs/1105.0673 (2011)
2010
[j28]
- view
  authority control:
- export record
  dblp key:
  - journals/tochi/TeevanDH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tochi/TeevanDH10
Jaime Teevan, Susan T. Dumais, Eric Horvitz:
Potential for personalization. ACM Trans. Comput. Hum. Interact. 17(1): 4:1-4:31 (2010)
[c90]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/TeevanDL10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/TeevanDL10
Jaime Teevan, Susan T. Dumais, Daniel J. Liebling:
A longitudinal study of how highlighting web content change affects people's web interactions. CHI 2010: 1353-1356
[c89]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/Dumais10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/Dumais10
Susan T. Dumais:
Temporal dynamics and information retrieval. CIKM 2010: 7-8
[c88]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WhiteBD10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WhiteBD10
Ryen W. White, Paul N. Bennett, Susan T. Dumais:
Predicting short-term interests using activity-based search context. CIKM 2010: 1009-1018
[c87]
- view
  authority control:
- export record
  dblp key:
  - conf/ercimdl/Dumais10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ercimdl/Dumais10
Susan T. Dumais:
Keynote: The Web Changes Everything: Understanding and Supporting People in Dynamic Information Environments. ECDL 2010: 1
[c86]
- view
  - electronic edition @ aaai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/icwsm/RamageDL10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/RamageDL10
Daniel Ramage, Susan T. Dumais, Daniel J. Liebling:
Characterizing Microblogs with Topic Models. ICWSM 2010
[c85]
- view
  authority control:
- export record
  dblp key:
  - conf/iiix/DumaisBC10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iiix/DumaisBC10
Susan T. Dumais, Georg Buscher, Edward Cutrell:
Individual differences in gaze patterns for web search. IIiX 2010: 185-194
[c84]
- view
  authority control:
- export record
  dblp key:
  - conf/riao/GuoWDWA10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/riao/GuoWDWA10
Qi Guo, Ryen W. White, Susan T. Dumais, Jue Wang, Blake Anderson:
Predicting query performance using query, result, and user interaction features. RIAO 2010: 198-201
[c83]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/BuscherDC10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/BuscherDC10
Georg Buscher, Susan T. Dumais, Edward Cutrell:
The good, the bad, and the random: an eye-tracking study of ad quality in web search. SIGIR 2010: 42-49
[c82]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/LiuWD10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/LiuWD10
Chao Liu, Ryen W. White, Susan T. Dumais:
Understanding web browsing behaviors through Weibull analysis of dwell time. SIGIR 2010: 379-386
[c81]
- view
  authority control:
- export record
  dblp key:
  - conf/um/WhiteKD10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/um/WhiteKD10
Ryen W. White, Ashish Kapoor, Susan T. Dumais:
Modeling Long-Term Search Engine Usage. UMAP 2010: 28-39
[c80]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/ElsasD10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/ElsasD10
Jonathan L. Elsas, Susan T. Dumais:
Leveraging temporal dynamics of document content in relevance ranking. WSDM 2010: 1-10
[c79]
- view
  authority control:
- export record
  dblp key:
  - conf/www/BennettSD10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/BennettSD10
Paul N. Bennett, Krysta M. Svore, Susan T. Dumais:
Classification-enhanced ranking. WWW 2010: 111-120

2000 – 2009

see FAQ

What is the meaning of the colors in the publication lists?

2009
[j27]
- view
  authority control:
- export record
  dblp key:
  - journals/computer/KellyDP09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/computer/KellyDP09
Diane Kelly, Susan T. Dumais, Jan O. Pedersen:
Evaluation Challenges and Directions for Information-Seeking Support Systems. Computer 42(3): 60-66 (2009)
[c78]
- view
  authority control:
- export record
  dblp key:
  - conf/asist/GwizdkaBDFG09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asist/GwizdkaBDFG09
Jacek Gwizdka, Nicholas J. Belkin, Susan T. Dumais, Luanne Freund, Susan Gauch:
Multiple facets of personalization. ASIST 2009: 1-7
[c77]
- view
  authority control:
- export record
  dblp key:
  - conf/candc/AndresTD09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/candc/AndresTD09
Paul André, m. c. schraefel, Jaime Teevan, Susan T. Dumais:
Discovery is never by chance: designing for (un)serendipity. Creativity & Cognition 2009: 305-314
[c76]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/AdarTD09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/AdarTD09
Eytan Adar, Jaime Teevan, Susan T. Dumais:
Resonance on the web: web dynamics and revisitation patterns. CHI 2009: 1381-1390
[c75]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/AndreTD09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/AndreTD09
Paul André, Jaime Teevan, Susan T. Dumais:
From x-rays to silly putty via Uranus: serendipity and its role in web search. CHI 2009: 2033-2036
[c74]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/WhiteD09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/WhiteD09
Ryen W. White, Susan T. Dumais:
Characterizing and predicting search engine switching behavior. CIKM 2009: 87-96
[c73]
- view
  - electronic edition @ aaai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/icwsm/HearstD09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/HearstD09
Marti A. Hearst, Susan T. Dumais:
Blogging Together: An Examination of Group Blogs. ICWSM 2009
[c72]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/Dumais09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Dumais09
Susan T. Dumais:
An interdisciplinary perspective on information retrieval. SIGIR 2009: 1-2
[c71]
- view
  authority control:
- export record
  dblp key:
  - conf/uist/TeevanDLH09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/uist/TeevanDLH09
Jaime Teevan, Susan T. Dumais, Daniel J. Liebling, Richard L. Hughes:
Changing how people view changes on the web. UIST 2009: 237-246
[c70]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/um/Dumais09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/um/Dumais09
Susan T. Dumais:
Thinking Outside the (Search) Box. UMAP 2009: 2
[c69]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/WhiteDT09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/WhiteDT09
Ryen W. White, Susan T. Dumais, Jaime Teevan:
Characterizing the influence of domain expertise on web search behavior. WSDM 2009: 132-141
[c68]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/AdarTDE09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/AdarTDE09
Eytan Adar, Jaime Teevan, Susan T. Dumais, Jonathan L. Elsas:
The web changes everything: understanding the dynamics of web content. WSDM 2009: 282-291
[r1]
- view
  authority control:
- export record
  dblp key:
  - reference/db/Dumais09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/db/Dumais09
Susan T. Dumais:
Faceted Search. Encyclopedia of Database Systems 2009: 1103-1109
2008
[j26]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/scholarpedia/LandauerD08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/scholarpedia/LandauerD08
Thomas K. Landauer, Susan T. Dumais:
Latent semantic analysis. Scholarpedia 3(11): 4356 (2008)
[j25]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/BarreauCDJP08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/BarreauCDJP08
Deborah Barreau, Robert Capra, Susan T. Dumais, William Jones, Manuel A. Pérez-Quiñones:
Introduction to keeping, refinding and sharing personal information. ACM Trans. Inf. Syst. 26(4): 18:1-18:3 (2008)
[c67]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/AdarTD08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/AdarTD08
Eytan Adar, Jaime Teevan, Susan T. Dumais:
Large scale analysis of web revisitation patterns. CHI 2008: 1197-1206
[c66]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/HearstHD08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/HearstHD08
Marti A. Hearst, Matthew Hurst, Susan T. Dumais:
What should blog search look like? SSM 2008: 95-98
[c65]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DowneyDLH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DowneyDLH08
Doug Downey, Susan T. Dumais, Daniel J. Liebling, Eric Horvitz:
Understanding the relationship between searchers' queries and information goals. CIKM 2008: 449-458
[c64]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/CarteretteBCD08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/CarteretteBCD08
Ben Carterette, Paul N. Bennett, David Maxwell Chickering, Susan T. Dumais:
Here or There. ECIR 2008: 16-27
[c63]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TeevanDL08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TeevanDL08
Jaime Teevan, Susan T. Dumais, Daniel J. Liebling:
To personalize or not to personalize: modeling queries with variation in user intent. SIGIR 2008: 163-170
[c62]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/WhiteDT08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/WhiteDT08
Ryen W. White, Susan T. Dumais, Jaime Teevan:
How medical expertise influences web search interaction. SIGIR 2008: 791-792
2007
[j24]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/CallanACDESZ07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/CallanACDESZ07
Jamie Callan, James Allan, Charles L. A. Clarke, Susan T. Dumais, David A. Evans, Mark Sanderson, ChengXiang Zhai:
Meeting of the MINDS: an information retrieval research agenda. SIGIR Forum 41(2): 25-34 (2007)
[c61]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/MetzlerDM07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/MetzlerDM07
Donald Metzler, Susan T. Dumais, Christopher Meek:
Similarity Measures for Short Segments of Text. ECIR 2007: 16-27
[c60]
- view
  authority control:
- export record
  dblp key:
  - conf/ecir/SandersonD07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecir/SandersonD07
Mark Sanderson, Susan T. Dumais:
Examining Repetition in User Search Behavior. ECIR 2007: 597-604
[c59]
- view
  - electronic edition @ ijcai.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/ijcai/DowneyDH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/DowneyDH07
Doug Downey, Susan T. Dumais, Eric Horvitz:
Models of Searching and Browsing: Languages, Studies, and Application. IJCAI 2007: 2740-2747
[c58]
- view
  authority control:
- export record
  dblp key:
  - conf/iui/Dumais07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/Dumais07
Susan T. Dumais:
Information retrieval in context. IUI 2007: 2
[c57]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/ClarkeADW07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/ClarkeADW07
Charles L. A. Clarke, Eugene Agichtein, Susan T. Dumais, Ryen W. White:
The influence of caption features on clickthrough patterns in web search. SIGIR 2007: 135-142
[c56]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TeevanDH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TeevanDH07
Jaime Teevan, Susan T. Dumais, Eric Horvitz:
Characterizing the value of personalizing search. SIGIR 2007: 757-758
[c55]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DowneyDH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DowneyDH07
Doug Downey, Susan T. Dumais, Eric Horvitz:
Heads and tails: studies of web search with common and rare queries. SIGIR 2007: 847-848
[c54]
- view
  authority control:
- export record
  dblp key:
  - conf/www/LeskovecDH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/LeskovecDH07
Jure Leskovec, Susan T. Dumais, Eric Horvitz:
Web projections: learning from contextual subgraphs of the web. WWW 2007: 471-480
2006
[j23]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/CutrellDT06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/CutrellDT06
Edward Cutrell, Susan T. Dumais, Jaime Teevan:
Searching to eliminate personal information management. Commun. ACM 49(1): 58-64 (2006)
[j22]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/CutrellD06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/CutrellD06
Edward Cutrell, Susan T. Dumais:
Exploring personal information. Commun. ACM 49(4): 50-51 (2006)
[c53]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/CutrellRDS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/CutrellRDS06
Edward Cutrell, Daniel C. Robbins, Susan T. Dumais, Raman Sarin:
Fast, flexible filtering with phlat. CHI 2006: 261-270
[c52]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/AgichteinBDR06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/AgichteinBDR06
Eugene Agichtein, Eric Brill, Susan T. Dumais, Robert Ragno:
Learning user interaction models for predicting web search result preferences. SIGIR 2006: 3-10
[c51]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/AgichteinBD06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/AgichteinBD06
Eugene Agichtein, Eric Brill, Susan T. Dumais:
Improving web search ranking by incorporating user behavior information. SIGIR 2006: 19-26
[c50]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/RadlinskiD06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/RadlinskiD06
Filip Radlinski, Susan T. Dumais:
Improving personalized web search using result diversification. SIGIR 2006: 691-692
[e3]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/2006
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/2006
Efthimis N. Efthimiadis, Susan T. Dumais, David Hawking, Kalervo Järvelin:
SIGIR 2006: Proceedings of the 29th Annual International ACM SIGIR Conference on Research and Development in Information Retrieval, Seattle, Washington, USA, August 6-11, 2006. ACM 2006, ISBN 1-59593-369-7 [contents]
2005
[j21]
- view
  authority control:
- export record
  dblp key:
  - journals/ir/BennettDH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ir/BennettDH05
Paul N. Bennett, Susan T. Dumais, Eric Horvitz:
The Combination of Text Classifiers Using Reliability Indicators. Inf. Retr. 8(1): 67-100 (2005)
[j20]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/FoxKMDW05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/FoxKMDW05
Steve Fox, Kuldeep Karnawat, Mark Mydland, Susan T. Dumais, Thomas White:
Evaluating implicit measures to improve web search. ACM Trans. Inf. Syst. 23(2): 147-168 (2005)
[c49]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/TeevanDH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/TeevanDH05
Jaime Teevan, Susan T. Dumais, Eric Horvitz:
Personalizing search via automated analysis of interests and activities. SIGIR 2005: 449-456
[c48]
- view
  authority control:
- export record
  dblp key:
  - conf/www/BroderMBDPPR05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/BroderMBDPPR05
Andrei Z. Broder, Yoëlle S. Maarek, Krishna Bharat, Susan T. Dumais, Steve Papa, Jan O. Pedersen, Prabhakar Raghavan:
Current trends in the integration of searching and browsing. WWW (Special interest tracks and posters) 2005: 793
[c47]
- view
  authority control:
- export record
  dblp key:
  - conf/www/ShenDH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/ShenDH05
Xuehua Shen, Susan T. Dumais, Eric Horvitz:
Analysis of topic dynamics in web search. WWW (Special interest tracks and posters) 2005: 1102-1103
2004
[j19]
- view
  authority control:
- export record
  dblp key:
  - journals/arist/Dumais04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/arist/Dumais04
Susan T. Dumais:
Latent semantic analysis. Annu. Rev. Inf. Sci. Technol. 38(1): 188-230 (2004)
[j18]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/AzariHDB04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/AzariHDB04
David Azari, Eric Horvitz, Susan T. Dumais, Eric Brill:
Actions, answers, and uncertainty: a decision-making perspective on Web-based question answering. Inf. Process. Manag. 40(5): 849-868 (2004)
[j17]
- view
  - electronic edition @ informationr.net (open access)
  - details & citations
- export record
  dblp key:
  - journals/ires/BruceJD04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ires/BruceJD04
Harry Bruce, William Paul Jones, Susan T. Dumais:
Information behaviour that keeps found things found. Inf. Res. 10(1) (2004)
[c46]
- view
  - electronic edition @ adcs-conference.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/adcs/Dumais04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adcs/Dumais04
Susan T. Dumais:
Personal Information Management: Stuff I've Seen and Beyond. ADCS 2004: 1
[c45]
- view
  authority control:
- export record
  dblp key:
  - conf/asist/Bruce0D04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asist/Bruce0D04
Harry Bruce, William Jones, Susan T. Dumais:
Keeping and re-finding information on the web: What do people do and what do they need? ASIST 2004: 129-137
[c44]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/PaekDL04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/PaekDL04
Tim Paek, Susan T. Dumais, Ron Logan:
WaveLens: a new view onto Internet search results. CHI 2004: 727-734
[c43]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/BelkinDSW04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/BelkinDSW04
Nicholas J. Belkin, Susan T. Dumais, Jean Scholtz, Ross Wilkinson:
Evaluating interactive information retrieval systems: opportunities and challenges. CHI Extended Abstracts 2004: 1594-1595
[c42]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DumaisCSH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DumaisCSH04
Susan T. Dumais, Edward Cutrell, Raman Sarin, Eric Horvitz:
Implicit queries (IQ) for contextualized search. SIGIR 2004: 594
[c41]
- view
  authority control:
- export record
  dblp key:
  - conf/www/GabrilovichDH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/GabrilovichDH04
Evgeniy Gabrilovich, Susan T. Dumais, Eric Horvitz:
Newsjunkie: providing personalized newsfeeds via analysis of information novelty. WWW 2004: 482-490
[e2]
- view
- export record
  dblp key:
  - conf/naacl/2004
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/2004
Julia Hirschberg, Susan T. Dumais, Daniel Marcu, Salim Roukos:
Human Language Technology Conference of the North American Chapter of the Association for Computational Linguistics, HLT-NAACL 2004, Boston, Massachusetts, USA, May 2-7, 2004. The Association for Computational Linguistics 2004 [contents]
2003
[j16]
- view
  authority control:
- export record
  dblp key:
  - journals/cogsci/Dumais03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cogsci/Dumais03
Susan T. Dumais:
Data-driven approaches to information access. Cogn. Sci. 27(3): 491-524 (2003)
[j15]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
James Allan, Jay Aslam, Nicholas J. Belkin, Chris Buckley, James P. Callan, W. Bruce Croft, Susan T. Dumais, Norbert Fuhr, Donna Harman, David J. Harper, Djoerd Hiemstra, Thomas Hofmann, Eduard H. Hovy, Wessel Kraaij, John D. Lafferty, Victor Lavrenko, David D. Lewis, Liz Liddy, R. Manmatha, Andrew McCallum, Jay M. Ponte, John M. Prager, Dragomir R. Radev, Philip Resnik, Stephen E. Robertson, Ronald Rosenfeld, Salim Roukos, Mark Sanderson, Richard M. Schwartz, Amit Singhal, Alan F. Smeaton, Howard R. Turtle, Ellen M. Voorhees, Ralph M. Weischedel, Jinxi Xu, ChengXiang Zhai:
Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002. SIGIR Forum 37(1): 31-47 (2003)
[j14]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/DumaisJBW03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/DumaisJBW03
Susan T. Dumais, Thorsten Joachims, Krishna Bharat, Andreas S. Weigend:
SIGIR 2003 workshop report: implicit measures of user interests and preferences. SIGIR Forum 37(2): 50-54 (2003)
[c40]
- view
  authority control:
- export record
  dblp key:
  - conf/group/PoltrockGDFBP03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/group/PoltrockGDFBP03
Steven E. Poltrock, Jonathan Grudin, Susan T. Dumais, Raya Fidel, Harry Bruce, Annelise Mark Pejtersen:
Information seeking and sharing in design teams. GROUP 2003: 239-247
[c39]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/interact/JonesBD03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/interact/JonesBD03
William Paul Jones, Harry Bruce, Susan T. Dumais:
How Do People Get Back to Information on the Web? How Can They Do It Better? INTERACT 2003
[c38]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/interact/RingelCDH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/interact/RingelCDH03
Meredith Ringel, Edward Cutrell, Susan T. Dumais, Eric Horvitz:
Milestones in Time: The Value of Landmarks in Retrieving Information from Personal Stores. INTERACT 2003
[c37]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DumaisCCJSR03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DumaisCCJSR03
Susan T. Dumais, Edward Cutrell, Jonathan J. Cadiz, Gavin Jancke, Raman Sarin, Daniel C. Robbins:
Stuff I've seen: a system for personal information retrieval and re-use. SIGIR 2003: 72-79
[c36]
- view
  - electronic edition @ dslpitt.org (archived)
  - details & citations
- export record
  dblp key:
  - conf/uai/AzariHDB03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/uai/AzariHDB03
David Azari, Eric Horvitz, Susan T. Dumais, Eric Brill:
Web-Based Question Answering: A Decision-Making Perspective. UAI 2003: 11-19
2002
[j13]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/Dumais02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/Dumais02
Susan T. Dumais:
Annual report for SIGIR, July 2001 - June 2002. SIGIR Forum 36(1): 2-4 (2002)
[j12]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/DumaisLS02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/DumaisLS02
Susan T. Dumais, David D. Lewis, Fabrizio Sebastiani:
Report on the workshop on Operational Text Classification Systems (OTC-02). SIGIR Forum 36(2): 68-71 (2002)
[c35]
- view
  authority control:
- export record
  dblp key:
  - conf/asist/0001DB02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/asist/0001DB02
William Jones, Susan T. Dumais, Harry Bruce:
Once found, what then? A study of "keeping" behaviors in the personal use of Web information. ASIST 2002: 391-402
[c34]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/BrillDB02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/BrillDB02
Eric Brill, Susan T. Dumais, Michele Banko:
An Analysis of the AskMSR Question-Answering System. EMNLP 2002: 257-264
[c33]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/BennettDH02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/BennettDH02
Paul N. Bennett, Susan T. Dumais, Eric Horvitz:
Probabilistic combination of text classifiers using reliability indicators: models and results. SIGIR 2002: 207-214
[c32]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DumaisBBLN02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DumaisBBLN02
Susan T. Dumais, Michele Banko, Eric Brill, Jimmy Lin, Andrew Y. Ng:
Web question answering: is more always better?. SIGIR 2002: 291-298
2001
[c31]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/DumaisCC01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/DumaisCC01
Susan T. Dumais, Edward Cutrell, Hao Chen:
Optimizing search by showing results in context. CHI 2001: 277-284
[c30]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/JonesBD01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/JonesBD01
William Paul Jones, Harry Bruce, Susan T. Dumais:
Keeping Found Things Found on the Web. CIKM 2001: 119-126
[c29]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/Collins-ThompsonSD01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/Collins-ThompsonSD01
Kevyn Collins-Thompson, Charles Schweizer, Susan T. Dumais:
Improved String Matching Under Noisy Channel Conditions. CIKM 2001: 357-364
[c28]
- view
  - electronic edition @ ercim.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/delos/Dumais01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/delos/Dumais01
Susan T. Dumais:
When do you want to go "where everybody knows your name" (and mailing address, and preferences, and last 50 web pages visited)?: A framework for personalization (Keynote Speech). DELOS 2001
[c27]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/interact/WenyinDSZCF01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/interact/WenyinDSZCF01
Liu Wenyin, Susan T. Dumais, Yanfeng Sun, HongJiang Zhang, Mary Czerwinski, Brent A. Field:
Semi-Automatic Image Annotation. INTERACT 2001: 326-333
[c26]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DumaisJ01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DumaisJ01
Susan T. Dumais, Rong Jin:
Probabilistic Combination of Content and Links. SIGIR 2001: 402-403
[c25]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/BrillLBDN01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/BrillLBDN01
Eric Brill, Jimmy Lin, Michele Banko, Susan T. Dumais, Andrew Y. Ng:
Data-Intensive Question Answering. TREC 2001
2000
[j11]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/Dumais00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/Dumais00
Susan T. Dumais:
Annual Report for SIGIR, July 1999 - June 2000. SIGIR Forum 34(1): 11-14 (2000)
[c24]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/ChenD00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/ChenD00
Hao Chen, Susan T. Dumais:
Bringing order to the Web: automatically categorizing search results. CHI 2000: 145-152
[c23]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/DumaisGPBFP00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/DumaisGPBFP00
Susan T. Dumais, Jonathan Grudin, Steven E. Poltrock, Harry Bruce, Raya Fidel, Annelise Mark Pejtersen:
Collaborative information retrieval (CIR). CHI Extended Abstracts 2000: 298
[c22]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DumaisC00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DumaisC00
Susan T. Dumais, Hao Chen:
Hierarchical classification of Web content. SIGIR 2000: 256-263

1990 – 1999

see FAQ

What is the meaning of the colors in the publication lists?

1999
[j10]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/BelkinD99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/BelkinD99
Nicholas J. Belkin, Susan T. Dumais:
Annual Report for SIGIR, July 1998 - June 1999. SIGIR Forum 33(2): 1-3 (1999)
[c21]
- view
  authority control:
- export record
  dblp key:
  - conf/adl/Dumais99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/adl/Dumais99
Susan T. Dumais:
Beyond Content-Based Retrieval: Modeling Domains, Users and Interaction. ADL 1999: 144-145
[c20]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/CzerwinskiDRDTD99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/CzerwinskiDRDTD99
Mary Czerwinski, Susan T. Dumais, George G. Robertson, Susan Dziadosz, Scott Lee Tiernan, Maarten van Dantzich:
Visualizing Implicit Queries for Information Management and Retrieval. CHI 1999: 560-567
1998
[j9]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/GordonD98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/GordonD98
Michael D. Gordon, Susan T. Dumais:
Using Latent Semantic Indexing for Literature Based Discovery. J. Am. Soc. Inf. Sci. 49(8): 674-685 (1998)
[c19]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/DumaisPHS98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/DumaisPHS98
Susan T. Dumais, John C. Platt, David Hecherman, Mehran Sahami:
Inductive Learning Algorithms and Representations for Text Categorization. CIKM 1998: 148-155
1997
[c18]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/RehderLDL97
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/RehderLDL97
Bob Rehder, Michael L. Littman, Susan T. Dumais, Thomas K. Landauer:
Automatic 3-Language Cross-Language Information Retrieval with Latent Semantic Indexing. TREC 1997: 233-239
1995
[j8]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/CaidDG95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/CaidDG95
William R. Caid, Susan T. Dumais, Stephen I. Gallant:
Learned Vector-Space Models for Document Retrieval. Inf. Process. Manag. 31(3): 419-429 (1995)
[j7]
- view
  authority control:
- export record
  dblp key:
  - journals/siamrev/BerryDO95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/siamrev/BerryDO95
Michael W. Berry, Susan T. Dumais, Gavin W. O'Brien:
Using Linear Algebra for Intelligent Information Retrieval. SIAM Rev. 37(4): 573-595 (1995)
[j6]
- view
  authority control:
- export record
  dblp key:
  - journals/software/Dumais95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/software/Dumais95
Susan T. Dumais:
Finding What You Want: New Tools And Tricks. IEEE Softw. 12(5): 79-81 (1995)
[c17]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/ppsc/BerryDO95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ppsc/BerryDO95
Michael W. Berry, Susan T. Dumais, Gavin W. O'Brien:
The Computationel Complexity of Alternative Updating Approaches for an SVD-Encoded Indexing Scheme. PP 1995: 39-44
[c16]
- view
  authority control:
- export record
  dblp key:
  - conf/sc/BerryDL95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sc/BerryDL95
Michael W. Berry, Susan T. Dumais, Todd A. Letsche:
Computational Methods for Intelligent Information Access. SC 1995: 20
1994
[c15]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/BelkinBDH94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/BelkinBDH94
Nicholas J. Belkin, Christine L. Borgman, Susan T. Dumais, Micheline Hancock-Beaulieu:
Evaluating Interactive Retrieval Systems. SIGIR 1994: 361
[c14]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/Dumais94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Dumais94
Susan T. Dumais:
Latent Semantic Indexing (LSI): TREC-3 Report. TREC 1994: 219-230
[e1]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/1994
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/1994
Beth Adelson, Susan T. Dumais, Judith S. Olson:
Conference on Human Factors in Computing Systems, CHI 1994, Boston, Massachusetts, USA, April 24-28, 1994, Proceedings. ACM 1994, ISBN 0-89791-650-6 [contents]
1993
[c13]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/Dumais93
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Dumais93
Susan T. Dumais:
Latent Semantic Indexing (LSI) and TREC-2. TREC 1993: 105-116
1992
[j5]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/FoltzD92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/FoltzD92
Peter W. Foltz, Susan T. Dumais:
Personalized Information Delivery: An Analysis of Information Filtering Methods. Commun. ACM 35(12): 51-60 (1992)
[c12]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/FoltzD92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/FoltzD92
Peter W. Foltz, Susan T. Dumais:
Personalized information delivery: an analysis of filtering methods. CHI Posters and Short Talks 1992: 4
[c11]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/DumaisN92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/DumaisN92
Susan T. Dumais, Jakob Nielsen:
Automating the Assignment of Submitted Manuscripts to Reviewers. SIGIR 1992: 233-244
[c10]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/Dumais92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Dumais92
Susan T. Dumais:
LSI meets TREC: A Status Report. TREC 1992: 137-152
[c9]
- view
  - electronic edition @ nist.gov (open access)
  - details & citations
- export record
  dblp key:
  - conf/trec/Dumais92a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/Dumais92a
Susan T. Dumais:
Automatically Generating Adhoc and Routing Queries. TREC 1992: 367-368
1990
[j4]
- view
  authority control:
- export record
  dblp key:
  - journals/jasis/DeerwesterDLFH90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jasis/DeerwesterDLFH90
Scott C. Deerwester, Susan T. Dumais, Thomas K. Landauer, George W. Furnas, Richard A. Harshman:
Indexing by Latent Semantic Analysis. J. Am. Soc. Inf. Sci. 41(6): 391-407 (1990)
[c8]
- view
  - electronic edition @ aaai.org (archived)
  - details & citations
- export record
  dblp key:
  - conf/aaai/Dumais90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/Dumais90
Susan T. Dumais:
Panel: User Modeling and User Interfaces. AAAI 1990: 1135-1136
[c7]
- view
  authority control:
- export record
  dblp key:
  - conf/cocs/KraulD90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cocs/KraulD90
Robert E. Kraut, Susan T. Dumais:
Computerization and the quality of working life: the role of control. COCS 1990: 56-68

1980 – 1989

see FAQ

What is the meaning of the colors in the publication lists?

1989
[j3]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/KrautDK89
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/KrautDK89
Robert E. Kraut, Susan T. Dumais, Susan Koch:
Computerization, Productivity, and Quality of Work-Life. Commun. ACM 32(2): 220-238 (1989)
1988
[c6]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/DumaisFLDH88
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/DumaisFLDH88
Susan T. Dumais, George W. Furnas, Thomas K. Landauer, Scott C. Deerwester, Richard A. Harshman:
Using latent semantic analysis to improve access to textual information. CHI 1988: 281-285
[c5]
- view
  authority control:
- export record
  dblp key:
  - conf/group/DumaisKK88
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/group/DumaisKK88
Susan T. Dumais, Robert E. Kraut, Susan Koch:
Computers' impact on productivity and work life. COCS 1988: 88-95
[c4]
- view
  authority control:
- export record
  dblp key:
  - conf/sigir/FurnasDDLHSL88
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/FurnasDDLHSL88
George W. Furnas, Scott C. Deerwester, Susan T. Dumais, Thomas K. Landauer, Richard A. Harshman, Lynn A. Streeter, Karen E. Lochbaum:
Information Retrieval using a Singular Value Decomposition Model of Latent Semantic Structure. SIGIR 1988: 465-480
1987
[j2]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/FurnasLGD87
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/FurnasLGD87
George W. Furnas, Thomas K. Landauer, Louis M. Gomez, Susan T. Dumais:
The Vocabulary Problem in Human-System Communication. Commun. ACM 30(11): 964-971 (1987)
1986
[j1]
- view
  authority control:
- export record
  dblp key:
  - journals/tois/JonesD86
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tois/JonesD86
William Paul Jones, Susan T. Dumais:
The Spatial Metaphor for User Interfaces: Experimental Tests of Reference by Location versus Name. ACM Trans. Inf. Syst. 4(1): 42-63 (1986)
1985
[c3]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/DumaisJ85
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/DumaisJ85
Susan T. Dumais, William Paul Jones:
A comparison of symbolic and spatial filing. CHI 1985: 127-130
1983
[c2]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/DumaisL83
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/DumaisL83
Susan T. Dumais, Thomas K. Landauer:
Using examples to describe categories. CHI 1983: 112-115
1982
[c1]
- view
  authority control:
- export record
  dblp key:
  - conf/chi/FurnasGLD82
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/chi/FurnasGLD82
George W. Furnas, Louis M. Gomez, Thomas K. Landauer, Susan T. Dumais:
Statistical semantics: How can a computer use what people name things to guess what things people mean when they name things? CHI 1982: 251-253

Coauthor Index

see FAQ

manage site settings

To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.