default search action

combined dblp search
author search
venue search
publication search

ask others

Sergio Consoli

> Home > Persons

Person information

affiliation: European Commission, Joint Research Centre (DG JRC), Brussels, Belgium
affiliation (former): Philips Research, Eindhoven, The Netherlands

Refine list

refinements active!

zoomed in on ?? of ?? records

view refined list in

export refined list as

showing all ?? records

Journal Articles

see FAQ

What is the meaning of the colors in the publication lists?

2024
[j29]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/access/AngioniCDORS24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/AngioniCDORS24
Simone Angioni, Sergio Consoli, Danilo Dessì, Francesco Osborne, Diego Reforgiato Recupero, Angelo A. Salatino:
Exploring Environmental, Social, and Governance (ESG) Discourse in News: An AI-Powered Investigation Through Knowledge Graph Analysis. IEEE Access 12: 77269-77283 (2024)
[j28]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/access/LombardoBCR24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/LombardoBCR24
Gianfranco Lombardo, Andrea Bertogalli, Sergio Consoli, Diego Reforgiato Recupero:
Natural Language Processing and Deep Learning for Bankruptcy Prediction: An End-to-End Architecture. IEEE Access 12: 151075-151091 (2024)
2023
[j27]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/epjds/RanjbaranRLC23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/epjds/RanjbaranRLC23
Golshid Ranjbaran, Diego Reforgiato Recupero, Gianfranco Lombardo, Sergio Consoli:
Leveraging augmentation techniques for tasks with unbalancedness within the financial domain: a two-level ensemble approach. EPJ Data Sci. 12(1): 24 (2023)
2022
[j26]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/access/CartaCGPR22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/CartaCGPR22
Salvatore M. Carta, Sergio Consoli, Alessandro Giuliani, Alessandro Sebastian Podda, Diego Reforgiato Recupero:
CulturAI: Semantic Enrichment of Cultural Data Leveraging Artificial Intelligence. IEEE Access 10: 127328-127344 (2022)
[j25]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/eswa/CartaCPRS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/eswa/CartaCPRS22
Salvatore Carta, Sergio Consoli, Alessandro Sebastian Podda, Diego Reforgiato Recupero, Maria Madalina Stanciu:
Statistical arbitrage powered by Explainable Artificial Intelligence. Expert Syst. Appl. 206: 117763 (2022)
[j24]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/kbs/ConsoliBM22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/kbs/ConsoliBM22
Sergio Consoli, Luca Barbaglia, Sebastiano Manzan:
Fine-grained, aspect-based sentiment analysis on economic and financial lexicon. Knowl. Based Syst. 247: 108781 (2022)
[j23]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/simpa/CartaCPRS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/simpa/CartaCPRS22
Salvatore Carta, Sergio Consoli, Alessandro Sebastian Podda, Diego Reforgiato Recupero, Maria Madalina Stanciu:
An eXplainable Artificial Intelligence tool for statistical arbitrage. Softw. Impacts 14: 100354 (2022)
2021
[j22]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/access/CartaCPRS21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/CartaCPRS21
Salvatore M. Carta, Sergio Consoli, Alessandro Sebastian Podda, Diego Reforgiato Recupero, Maria Madalina Stanciu:
Ensembling and Dynamic Asset Selection for Risk-Controlled Statistical Arbitrage. IEEE Access 9: 29942-29959 (2021)
[j21]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/access/CartaCPPR21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/CartaCPPR21
Salvatore M. Carta, Sergio Consoli, Luca Piras, Alessandro Sebastian Podda, Diego Reforgiato Recupero:
Explainable Machine Learning Exploiting News and Domain-Specific Lexicon for Stock Market Forecasting. IEEE Access 9: 30193-30205 (2021)
[j20]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/peerj-cs/CartaCPPR21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/peerj-cs/CartaCPPR21
Salvatore Carta, Sergio Consoli, Luca Piras, Alessandro Sebastian Podda, Diego Reforgiato Recupero:
Event detection in finance using hierarchical clustering algorithms on news and tweets. PeerJ Comput. Sci. 7: e438 (2021)
2020
[j19]
- view
  authority control:
- export record
  dblp key:
  - journals/jgo/ConsoliKPG20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jgo/ConsoliKPG20
Sergio Consoli, Jan H. M. Korst, Steffen Pauws, Gijs Geleijnse:
Improved metaheuristics for the quartet method of hierarchical clustering. J. Glob. Optim. 78(2): 241-270 (2020)
2019
[j18]
- view
  authority control:
- export record
  dblp key:
  - journals/4or/ConsoliKGP19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/4or/ConsoliKGP19
Sergio Consoli, Jan H. M. Korst, Gijs Geleijnse, Steffen Pauws:
An exact algorithm for the minimum quartet tree cost problem. 4OR 17(4): 401-425 (2019)
2017
[j17]
- view
  authority control:
- export record
  dblp key:
  - journals/bdr/ConsoliPRNPMG17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bdr/ConsoliPRNPMG17
Sergio Consoli, Valentina Presutti, Diego Reforgiato Recupero, Andrea Giovanni Nuzzolese, Silvio Peroni, Misael Mongiovì, Aldo Gangemi:
Producing Linked Data for Smart Cities: The Case of Catania. Big Data Res. 7: 1-15 (2017)
[j16]
- view
  authority control:
- export record
  dblp key:
  - journals/itor/ConsoliS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/itor/ConsoliS17
Sergio Consoli, Nikolaos I. Stilianakis:
A quartet method based on variable neighborhood search for biomedical literature extraction and clustering. Int. Trans. Oper. Res. 24(3): 537-558 (2017)
[j15]
- view
  authority control:
- export record
  dblp key:
  - journals/itor/ConsoliMM17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/itor/ConsoliMM17
Sergio Consoli, José Andrés Moreno-Pérez, Nenad Mladenovic:
Comparison of metaheuristics for the k-labeled spanning forest problem. Int. Trans. Oper. Res. 24(3): 559-582 (2017)
2016
[j14]
- view
  authority control:
- export record
  dblp key:
  - journals/ida/ConsoliTP16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ida/ConsoliTP16
Sergio Consoli, Marco Turchi, Domenico Perrotta:
A local search approach for generating directional data. Intell. Data Anal. 20(2): 439-453 (2016)
[j13]
- view
  authority control:
- export record
  dblp key:
  - journals/kbs/MongioviRGPC16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/kbs/MongioviRGPC16
Misael Mongiovì, Diego Reforgiato Recupero, Aldo Gangemi, Valentina Presutti, Sergio Consoli:
Merging open knowledge extracted from text with MERGILO. Knowl. Based Syst. 108: 155-167 (2016)
[j12]
- view
  authority control:
- export record
  dblp key:
  - journals/semweb/PresuttiNCGR15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/semweb/PresuttiNCGR15
Valentina Presutti, Andrea Giovanni Nuzzolese, Sergio Consoli, Aldo Gangemi, Diego Reforgiato Recupero:
From hyperlinks to Semantic Web properties using Open Knowledge Extraction. Semantic Web 7(4): 351-378 (2016)
2015
[j11]
- view
  authority control:
- export record
  dblp key:
  - journals/asc/ConsoliMM15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/asc/ConsoliMM15
Sergio Consoli, Nenad Mladenovic, José A. Moreno-Pérez:
Solving the minimum labelling spanning tree problem by intelligent optimization. Appl. Soft Comput. 28: 440-452 (2015)
[j10]
- view
  authority control:
- export record
  dblp key:
  - journals/cogcom/RecuperoPCGN15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cogcom/RecuperoPCGN15
Diego Reforgiato Recupero, Valentina Presutti, Sergio Consoli, Aldo Gangemi, Andrea Giovanni Nuzzolese:
Sentilo: Frame-Based Sentiment Analysis. Cogn. Comput. 7(2): 211-225 (2015)
[j9]
- view
  authority control:
- export record
  dblp key:
  - journals/endm/ConsoliS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/endm/ConsoliS15
Sergio Consoli, Nikolaos I. Stilianakis:
A VNS-based quartet algorithm for biomedical literature clustering. Electron. Notes Discret. Math. 47: 13-20 (2015)
[j8]
- view
  authority control:
- export record
  dblp key:
  - journals/endm/ConsoliM15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/endm/ConsoliM15
Sergio Consoli, José Andrés Moreno-Pérez:
Variable neighbourhood search for the k-labelled spanning forest problem. Electron. Notes Discret. Math. 47: 29-36 (2015)
2013
[j7]
- view
  authority control:
- export record
  dblp key:
  - journals/endm/ConsoliMM13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/endm/ConsoliMM13
Sergio Consoli, José Andrés Moreno-Pérez, Nenad Mladenovic:
Intelligent variable neighbourhood search for the minimum labelling spanning tree problem. Electron. Notes Discret. Math. 41: 399-406 (2013)
2012
[j6]
- view
  authority control:
- export record
  dblp key:
  - journals/4or/Consoli12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/4or/Consoli12
Sergio Consoli:
The development and application of metaheuristics for problems in graph theory: a computational study. 4OR 10(3): 319-320 (2012)
[j5]
- view
  authority control:
- export record
  dblp key:
  - journals/endm/ConsoliM12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/endm/ConsoliM12
Sergio Consoli, José A. Moreno-Pérez:
Solving the minimum labelling spanning tree problem using hybrid local search. Electron. Notes Discret. Math. 39: 75-82 (2012)
2010
[j4]
- view
  authority control:
- export record
  dblp key:
  - journals/nc/ConsoliMDM10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nc/ConsoliMDM10
Sergio Consoli, José Andrés Moreno-Pérez, Kenneth Darby-Dowman, Nenad Mladenovic:
Discrete Particle Swarm Optimization for the minimum labelling Steiner tree problem. Nat. Comput. 9(1): 29-46 (2010)
[j3]
- view
  authority control:
- export record
  dblp key:
  - journals/tkde/ConsoliDGKP10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tkde/ConsoliDGKP10
Sergio Consoli, Kenneth Darby-Dowman, Gijs Geleijnse, Jan H. M. Korst, Steffen Pauws:
Heuristic Approaches for the Quartet Method of Hierarchical Clustering. IEEE Trans. Knowl. Data Eng. 22(10): 1428-1443 (2010)
2009
[j2]
- view
  authority control:
- export record
  dblp key:
  - journals/anor/ConsoliDMM09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/anor/ConsoliDMM09
Sergio Consoli, Ken Darby-Dowman, Nenad Mladenovic, José A. Moreno-Pérez:
Variable neighbourhood search for the minimum labelling Steiner tree problem. Ann. Oper. Res. 172(1): 71-96 (2009)
[j1]
- view
  authority control:
- export record
  dblp key:
  - journals/eor/ConsoliDMM09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/eor/ConsoliDMM09
Sergio Consoli, Ken Darby-Dowman, Nenad Mladenovic, José A. Moreno-Pérez:
Greedy Randomized Adaptive Search and Variable Neighbourhood Search for the minimum labelling spanning tree problem. Eur. J. Oper. Res. 196(2): 440-449 (2009)

Conference and Workshop Papers

see FAQ

What is the meaning of the colors in the publication lists?

2024
[c47]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/semtech4stld/AngioniCDORS24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semtech4stld/AngioniCDORS24
Simone Angioni, Sergio Consoli, Danilo Dessì, Francesco Osborne, Diego Reforgiato Recupero, Angelo A. Salatino:
Investigating Environmental, Social, and Governance (ESG) Discussions in News: A Knowledge Graph Analysis Empowered by AI. SemTech4STLD@ESWC 2024: 49-60
[c46]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/text2kg/GallardoCCHB24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/text2kg/GallardoCCHB24
Antonio Puertas Gallardo, Sergio Consoli, Mario Ceresa, Roel Hulsman, Lorenzo Bertolini:
On Constructing Biomedical Text-to-Graph Systems with Large Language Models. TEXT2KG/DQMLKG@ESWC 2024: 12
[c45]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/text2kg/DessiFCZOBAR24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/text2kg/DessiFCZOBAR24
Danilo Dessì, Gianni Fenu, Sergio Consoli, Vanni Zavarella, Francesco Osborne, Davide Buscaldi, Simone Angioni, Diego Reforgiato Recupero:
Knowledge Graphs for Digital Transformation Monitoring in Social Media. TEXT2KG/DQMLKG@ESWC 2024: 13
[c44]
- view
  authority control:
- export record
  dblp key:
  - conf/um/ZavarellaRCF24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/um/ZavarellaRCF24
Vanni Zavarella, Diego Reforgiato Recupero, Sergio Consoli, Gianni Fenu:
Charting the Landscape of Digital Health: Towards A Knowledge Graph Approach to News Media Analysis. UMAP (Adjunct Publication) 2024
2023
[c43]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/centeris/SorribesLGPCGC23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/centeris/SorribesLGPCGC23
Manel Gil Sorribes, Gabriele Leoni, Antonio Puertas Gallardo, Mauro Petrillo, Sergio Consoli, Vicenç Gómez, Mario Ceresa:
ML-based predictive gut microbiome analysis for health assessment. CENTERIS/ProjMAN/HCist 2023: 1452-1459
2022
[c42]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/bioma/ConsoliM22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bioma/ConsoliM22
Sergio Consoli, José Andrés Moreno-Pérez:
Evaluating the Effects of Chaos in Variable Neighbourhood Search. MIC 2022: 200-214
[c41]
- view
  authority control:
- export record
  dblp key:
  - conf/goodit/ColagrossiCPB22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/goodit/ColagrossiCPB22
Marco Colagrossi, Sergio Consoli, Francesco Panella, Luca Barbaglia:
Tracking socio-economic activities in European countries with unconventional data. GoodIT 2022: 323-330
[c40]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/pkdd/ConsoliCPB22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/ConsoliCPB22
Sergio Consoli, Marco Colagrossi, Francesco Panella, Luca Barbaglia:
On the Development of a European Tracker of Societal Issues and Economic Activities Using Alternative Data. PKDD/ECML Workshops (2) 2022: 38-43
2021
[c39]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/esws/ConsoliBM21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/ConsoliBM21
Sergio Consoli, Luca Barbaglia, Sebastiano Manzan:
Explaining Sentiment from Lexicon. DeepOntoNLP/X-SENTIMENT@ESWC 2021: 87-95
[c38]
- view
  authority control:
- export record
  dblp key:
  - conf/icfnds/AngioniCCRS21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icfnds/AngioniCCRS21
Simone Angioni, Salvatore Carta, Sergio Consoli, Diego Reforgiato Recupero, Maria Madalina Stanciu:
A Big Data framework based on Apache Spark for Industry-specific Lexicon Generation for Stock Market Prediction. ICFNDS 2021: 616-624
[c37]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/icvns/ConsoliPT21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icvns/ConsoliPT21
Sergio Consoli, Domenico Perrotta, Marco Turchi:
Reduced Variable Neighbourhood Search for the Generation of Controlled Circular Data. ICVNS 2021: 83-98
[c36]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/mod/ConsoliNTTT21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mod/ConsoliNTTT21
Sergio Consoli, Matteo Negri, Amirhossein Tebbifakhr, Elisa Tosetti, Marco Turchi:
Forecasting the IBEX-35 Stock Index Using Deep Learning and News Emotions. LOD 2021: 308-323
[c35]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/pkdd/BarbagliaCW21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/BarbagliaCW21
Luca Barbaglia, Sergio Consoli, Susan Wang:
Financial Forecasting with Word Embeddings Extracted from News: A Preliminary Analysis. PKDD/ECML Workshops (2) 2021: 179-188
[c34]
- view
  authority control:
- export record
  dblp key:
  - conf/pkdd/ConsoliNTTT21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/ConsoliNTTT21
Sergio Consoli, Matteo Negri, Amirhossein Tebbifakhr, Elisa Tosetti, Marco Turchi:
On Neural Forecasting and News Emotions: The Case of the Spanish Stock Market. PKDD/ECML Workshops (2) 2021: 189-194
2020
[c33]
- view
  authority control:
- export record
  dblp key:
  - conf/cogmi/ConsoliBM20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cogmi/ConsoliBM20
Sergio Consoli, Luca Barbaglia, Sebastiano Manzan:
Fine-grained, aspect-based semantic sentiment analysis within the economic and financial domains. CogMI 2020: 52-61
[c32]
- view
  authority control:
- export record
  dblp key:
  - conf/icfnds/CartaCCDPR20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icfnds/CartaCCDPR20
Salvatore Carta, Sergio Consoli, Andrea Corriga, Raffaele Dapiaggi, Alessandro Sebastian Podda, Diego Reforgiato Recupero:
HawkEye: a Visual Framework for Agile Cross-Validation of Deep Learning Approaches in Financial Forecasting. ICFNDS 2020: 46:1-46:6
[c31]
- view
  authority control:
- export record
  dblp key:
  - conf/iui/ConsoliRR20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/ConsoliRR20
Sergio Consoli, Diego Reforgiato Recupero, Daniele Riboni:
SmartPHIL: 1st Workshop on Smart Personal Health Interfaces. IUI Companion 2020: 5-6
[c30]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/iui/ConsoliDFM20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/ConsoliDFM20
Sergio Consoli, Danilo Dessì, Gianni Fenu, Mirko Marras:
Deep Attention-based Model for Helpfulness Prediction of Healthcare Online Reviews. SmartPhil@IUI 2020: 33-49
[c29]
- view
  authority control:
- export record
  dblp key:
  - conf/mod/CartaCPPR20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mod/CartaCPPR20
Salvatore Carta, Sergio Consoli, Luca Piras, Alessandro Sebastian Podda, Diego Reforgiato Recupero:
Dynamic Industry-Specific Lexicon Generation for Stock Market Forecast. LOD (1) 2020: 162-176
[c28]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/mod/ConsoliPT20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mod/ConsoliPT20
Sergio Consoli, Luca Tiozzo Pezzoli, Elisa Tosetti:
Using the GDELT Dataset to Analyse the Italian Sovereign Bond Market. LOD (1) 2020: 190-202
[c27]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/pkdd/ConsoliPT20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/ConsoliPT20
Sergio Consoli, Luca Tiozzo Pezzoli, Elisa Tosetti:
Information Extraction From the GDELT Database to Analyse EU Sovereign Bond Markets. MIDAS@PKDD/ECML 2020: 55-67
[c26]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/pkdd/BarbagliaCM20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/BarbagliaCM20
Luca Barbaglia, Sergio Consoli, Sebastiano Manzan:
Exploring the Predictive Power of News and Neural Machine Learning Models for Economic Forecasting. MIDAS@PKDD/ECML 2020: 135-149
[c25]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/semweb/ConsoliWOH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semweb/ConsoliWOH20
Sergio Consoli, Kees Wouters, Renée A. Otte, Adrienne Heinrich:
A Newborn Development Insights Mining and Recommendation System from Scientific Literature and Clinical Guidelines. SWH@ISWC 2020: 30-41
2019
[c24]
- view
  authority control:
- export record
  dblp key:
  - conf/pkdd/BarbagliaCM19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/BarbagliaCM19
Luca Barbaglia, Sergio Consoli, Sebastiano Manzan:
Monitoring the Business Cycle with Fine-Grained, Aspect-Based Sentiment Extraction from News. MIDAS@PKDD 2019: 101-106
[c23]
- view
  authority control:
- export record
  dblp key:
  - conf/pkdd/PezzoliCT19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/PezzoliCT19
Luca Tiozzo Pezzoli, Sergio Consoli, Elisa Tosetti:
Big Data Financial Sentiment Analysis in the European Bond Markets. MIDAS@PKDD 2019: 122-126
2018
[c22]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/icvns/ConsoliKPG18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icvns/ConsoliKPG18
Sergio Consoli, Jan H. M. Korst, Steffen Pauws, Gijs Geleijnse:
Improved Variable Neighbourhood Search Heuristic for Quartet Clustering. ICVNS 2018: 1-12
[c21]
- view
  authority control:
- export record
  dblp key:
  - conf/ijcai/ChaouaCHHR18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/ChaouaCHHR18
Ilyas Chaoua, Sergio Consoli, Aki Härmä, Rim Helaoui, Diego Reforgiato Recupero:
Analysis of Topic Propagation in Therapy Sessions Using Partially Labeled Latent Dirichlet Allocation. AIH@IJCAI (Revised Selected Papers) 2018: 59-75
[c20]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/ijcai/ChaouaRCHH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/ChaouaRCHH18
Ilyas Chaoua, Diego Reforgiato Recupero, Sergio Consoli, Aki Härmä, Rim Helaoui:
Detecting and tracking ongoing topics in psychotherapeutic conversations. AIH@IJCAI 2018: 97-108
[c19]
- view
  authority control:
- export record
  dblp key:
  - conf/mod/KnippenbergMC18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mod/KnippenbergMC18
Marijn van Knippenberg, Vlado Menkovski, Sergio Consoli:
Evolutionary Construction of Convolutional Neural Networks. LOD 2018: 293-304
[c18]
- view
  authority control:
- export record
  dblp key:
  - conf/mod/ConsoliHVKMH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mod/ConsoliHVKMH18
Sergio Consoli, Monique Hendriks, Pieter C. Vos, Jacek Kustra, Dimitrios Mavroeidis, Ralf Hoffmann:
Improving Clinical Subjects Clustering by Learning and Optimizing Feature Weights. LOD 2018: 305-316
2017
[c17]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/esws/DessiRFC17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/DessiRFC17
Danilo Dessì, Diego Reforgiato Recupero, Gianni Fenu, Sergio Consoli:
Exploiting Cognitive Computing and Frame Semantic Features for Biomedical Document Clustering. SeWeBMeDA@ESWC 2017: 20-34
[c16]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/i-semantics/ConsoliZBKL17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/i-semantics/ConsoliZBKL17
Sergio Consoli, Xiao Ming Zhou, Wei Shun Bao, Declan P. Kelly, Vincent Lou:
Semantic Mining of Respiratory Health Knowledge from Scientific Literature. SEMANTiCS (Posters & Demos) 2017
[c15]
- view
  authority control:
- export record
  dblp key:
  - conf/mod/ConsoliKVHM17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mod/ConsoliKVHM17
Sergio Consoli, Jacek Kustra, Pieter C. Vos, Monique Hendriks, Dimitrios Mavroeidis:
Improving Support Vector Machines Performance Using Local Search. MOD 2017: 16-28
2015
[c14]
- view
  authority control:
- export record
  dblp key:
  - conf/esws/ConsoliR15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/ConsoliR15
Sergio Consoli, Diego Reforgiato Recupero:
Using FRED for Named Entity Resolution, Linking and Typing for Knowledge Base Population. SemWebEval@ESWC 2015: 40-50
[c13]
- view
  authority control:
- export record
  dblp key:
  - conf/kcap/MongioviRGPNC15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kcap/MongioviRGPNC15
Misael Mongiovì, Diego Reforgiato Recupero, Aldo Gangemi, Valentina Presutti, Andrea Giovanni Nuzzolese, Sergio Consoli:
Semantic reconciliation of knowledge extracted from text through a novel machine reader. K-CAP 2015: 25:1-25:4
[c12]
- view
  authority control:
- export record
  dblp key:
  - conf/www/RecuperoNCPMP15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/RecuperoNCPMP15
Diego Reforgiato Recupero, Andrea Giovanni Nuzzolese, Sergio Consoli, Valentina Presutti, Misael Mongiovì, Silvio Peroni:
Extracting knowledge from text using SHELDON, a Semantic Holistic framEwork for LinkeD ONtology data. WWW (Companion Volume) 2015: 235-238
[c11]
- view
  authority control:
- export record
  dblp key:
  - conf/www/ConsoliRMPCP15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/ConsoliRMPCP15
Sergio Consoli, Diego Reforgiato Recupero, Misael Mongiovì, Valentina Presutti, Gianni Cataldi, Wladimiro Patatu:
An Urban Fault Reporting and Management Platform for Smart Cities. WWW (Companion Volume) 2015: 535-540
[c10]
- view
  authority control:
- export record
  dblp key:
  - conf/www/ConsoliMNPPRS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/ConsoliMNPPRS15
Sergio Consoli, Misael Mongiovì, Andrea Giovanni Nuzzolese, Silvio Peroni, Valentina Presutti, Diego Reforgiato Recupero, Daria Spampinato:
A Smart City Data Model based on Semantics Best Practice and Principles. WWW (Companion Volume) 2015: 1395-1400
2014
[c9]
- view
  authority control:
- export record
  dblp key:
  - conf/ekaw/RecuperoNCGP14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ekaw/RecuperoNCGP14
Diego Reforgiato Recupero, Andrea Giovanni Nuzzolese, Sergio Consoli, Aldo Gangemi, Valentina Presutti:
SHELDON: Semantic Holistic FramEwork for LinkeD ONtology Data. EKAW (Satellite Events) 2014: 136-139
[c8]
- view
  authority control:
- export record
  dblp key:
  - conf/ekaw/ConsoliNPRG14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ekaw/ConsoliNPRG14
Sergio Consoli, Andrea Giovanni Nuzzolese, Valentina Presutti, Diego Reforgiato Recupero, Aldo Gangemi:
Legalo: Revealing the Semantics of Links. EKAW (Satellite Events) 2014: 140-144
[c7]
- view
  authority control:
- export record
  dblp key:
  - conf/ekaw/PresuttiCNRGBZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ekaw/PresuttiCNRGBZ14
Valentina Presutti, Sergio Consoli, Andrea Giovanni Nuzzolese, Diego Reforgiato Recupero, Aldo Gangemi, Ines Bannour, Haïfa Zargayouna:
Uncovering the Semantics of Wikipedia Pagelinks. EKAW 2014: 413-428
[c6]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/esws/RecuperoGNCSP14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/RecuperoGNCSP14
Diego Reforgiato Recupero, Aldo Gangemi, Andrea Giovanni Nuzzolese, Sergio Consoli, Daria Spampinato, Valentina Presutti:
Semantic Web-based Sentiment Analysis. SSA-SMILE@ESWC 2014: 25-28
[c5]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/esws/ConsoliGNPPRS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/ConsoliGNPPRS14
Sergio Consoli, Aldo Gangemi, Andrea Giovanni Nuzzolese, Silvio Peroni, Valentina Presutti, Diego Reforgiato Recupero, Daria Spampinato:
Towards emergency vehicle routing using Geolinked Open Data: the case study of the Municipality of Catania. SSA-SMILE@ESWC 2014: 31-42
[c4]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/esws/ConsoliGNPRS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/ConsoliGNPRS14
Sergio Consoli, Aldo Gangemi, Andrea Giovanni Nuzzolese, Silvio Peroni, Diego Reforgiato Recupero, Daria Spampinato:
Setting the Course of Emergency Vehicle Routing Using Geolinked Open Data for the Municipality of Catania. ESWC (Satellite Events) 2014: 42-53
[c3]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/esws/RecuperoCGNS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/RecuperoCGNS14
Diego Reforgiato Recupero, Sergio Consoli, Aldo Gangemi, Andrea Giovanni Nuzzolese, Daria Spampinato:
A Semantic Web Based Core Engine to Efficiently Perform Sentiment Analysis. ESWC (Satellite Events) 2014: 245-248
[c2]
- view
  authority control:
- export record
  dblp key:
  - conf/wims/ConsoliGNPPRS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wims/ConsoliGNPPRS14
Sergio Consoli, Aldo Gangemi, Andrea Giovanni Nuzzolese, Silvio Peroni, Valentina Presutti, Diego Reforgiato Recupero, Daria Spampinato:
Geolinked Open Data for the Municipality of Catania. WIMS 2014: 58:1-58:8
2013
[c1]
- view
  authority control:
- export record
  dblp key:
  - conf/lion/ConsoliMM13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lion/ConsoliMM13
Sergio Consoli, José Andrés Moreno-Pérez, Nenad Mladenovic:
Intelligent Optimization for the Minimum Labelling Spanning Tree Problem. LION 2013: 19-23

Parts in Books or Collections

see FAQ

What is the meaning of the colors in the publication lists?

2019
[p5]
- view
  authority control:
- export record
  dblp key:
  - books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19
Ziawasch Abedjan, Nozha Boujemaa, Stuart Campbell, Patricia Casla, Supriyo Chatterjea, Sergio Consoli, Cristóbal Costa Soria, Paul Czech, Marija Despenic, Chiara Garattini, Dirk Hamelinck, Adrienne Heinrich, Wessel Kraaij, Jacek Kustra, Aizea Lojo, Marga Martin Sanchez, Miguel Angel Mayer, Matteo Melideo, Ernestina Menasalvas, Frank Møller Aarestrup, Elvira Narro Artigot, Milan Petkovic, Diego Reforgiato Recupero, Alejandro Rodríguez González, Gisele Roesems Kerremans, Roland Roller, Mário Romão, Stefan Rüping, Felix Sasaki, Wouter Spek, Nenad Stojanovic, Jack Thoms, Andrejs Vasiljevs, Wilfried Verachtert, Roel Wuyts:
Data Science in Healthcare: Benefits, Challenges and Opportunities. Data Science for Healthcare 2019: 3-38
[p4]
- view
  authority control:
- export record
  dblp key:
  - books/sp/19/KorstPBC19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/19/KorstPBC19
Jan H. M. Korst, Verus Pronk, Mauro Barbieri, Sergio Consoli:
Introduction to Classification Algorithms and Their Performance Analysis Using Medical Examples. Data Science for Healthcare 2019: 39-73
[p3]
- view
  authority control:
- export record
  dblp key:
  - books/sp/19/HendriksXVCK19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/19/HendriksXVCK19
Monique Hendriks, Charalampos Xanthopoulakis, Pieter C. Vos, Sergio Consoli, Jacek Kustra:
Data Visualization in Clinical Practice. Data Science for Healthcare 2019: 289-304
[p2]
- view
  authority control:
- export record
  dblp key:
  - series/isrl/DessiRFC19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/isrl/DessiRFC19
Danilo Dessì, Diego Reforgiato Recupero, Gianni Fenu, Sergio Consoli:
A Recommender System of Medical Reports Leveraging Cognitive Computing and Frame Semantics. Machine Learning Paradigms 2019: 7-30
2007
[p1]
- view
  authority control:
- export record
  dblp key:
  - series/sci/ConsoliMDM07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sci/ConsoliMDM07
Sergio Consoli, José A. Moreno-Pérez, Ken Darby-Dowman, Nenad Mladenovic:
Discrete Particle Swarm Optimization for the Minimum Labelling Steiner Tree Problem. NICSO 2007: 313-322

Editorship

see FAQ

What is the meaning of the colors in the publication lists?

2020
[e2]
- view
- export record
  dblp key:
  - conf/iui/2020smartphil
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/2020smartphil
Sergio Consoli, Diego Reforgiato Recupero, Daniele Riboni:
Proceedings of the First Workshop on Smart Personal Health Interfaces co-located with 25th International Conference on Intelligent User Interfaces, SmartPhil@IUI 2020, Cagliari, Italy, March 17, 2020. CEUR Workshop Proceedings 2596, CEUR-WS.org 2020 [contents]
2019
[e1]
- view
  authority control:
- export record
  dblp key:
  - books/sp/CRP2019
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/CRP2019
Sergio Consoli, Diego Reforgiato Recupero, Milan Petkovic:
Data Science for Healthcare - Methodologies and Applications. Springer 2019, ISBN 978-3-030-05248-5 [contents]

Informal and Other Publications

see FAQ

What is the meaning of the colors in the publication lists?

2024
[i24]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2401-07179
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2401-07179
Luca Barbaglia, Sergio Consoli, Sebastiano Manzan:
Forecasting GDP in Europe with Textual Data. CoRR abs/2401.07179 (2024)
[i23]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2402-07335
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2402-07335
Sergio Consoli, Valentina Alberti, Cinzia Cocco, Francesco Panella, Valentina Montalto:
Cultural gems linked open data: Mapping culture and intangible heritage in European cities. CoRR abs/2402.07335 (2024)
[i22]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2402-07339
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2402-07339
Oscar Araque, Luca Barbaglia, Francesco Berlingieri, Marco Colagrossi, Sergio Consoli, Lorenzo Gatti, Caterina Mauri, Kyriaki Kalimeri:
Beyond the Headlines: Understanding Sentiments and Morals Impacting Female Employment in Spain. CoRR abs/2402.07339 (2024)
[i21]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2402-07351
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2402-07351
Valentina Alberti, Cinzia Cocco, Sergio Consoli, Valentina Montalto, Francesco Panella:
Ontology Engineering to Model the European Cultural Heritage: The Case of Cultural Gems. CoRR abs/2402.07351 (2024)
[i20]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2407-11862
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2407-11862
Oscar Araque, Lorenzo Gatti, Sergio Consoli, Kyriaki Kalimeri:
A Novel Lexicon for the Moral Foundation of Liberty. CoRR abs/2407.11862 (2024)
[i19]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2408-02377
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2408-02377
Vanni Zavarella, Juan Carlos Gamero-Salinas, Sergio Consoli:
A Few-Shot Approach for Relation Extraction Domain Adaptation using Large Language Models. CoRR abs/2408.02377 (2024)
[i18]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2408-14277
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2408-14277
Sergio Consoli, Peter Markov, Nikolaos I. Stilianakis, Lorenzo Bertolini, Antonio Puertas Gallardo, Mario Ceresa:
Epidemic Information Extraction for Event-Based Surveillance using Large Language Models. CoRR abs/2408.14277 (2024)
[i17]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2408-14908
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2408-14908
Vanni Zavarella, Sergio Consoli, Diego Reforgiato Recupero, Gianni Fenu, Simone Angioni, Davide Buscaldi, Danilo Dessì, Francesco Osborne:
Triplètoile: Extraction of Knowledge from Microblogging Text. CoRR abs/2408.14908 (2024)
[i16]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2411-13958
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2411-13958
Luca Barbaglia, Sergio Consoli, Sebastiano Manzan, Luca Tiozzo Pezzoli, Elisa Tosetti:
Sentiment Analysis of Economic Text: A Lexicon-Based Approach. CoRR abs/2411.13958 (2024)
2022
[i15]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2203-07071
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2203-07071
Sergio Consoli, Luca Tiozzo Pezzoli, Elisa Tosetti:
Neural Forecasting of the Italian Sovereign Bond Market with Economic News. CoRR abs/2203.07071 (2022)
[i14]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2203-15686
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2203-15686
Luca Barbaglia, Sergio Consoli, Sebastiano Manzan:
Forecasting with Economic News. CoRR abs/2203.15686 (2022)
2021
[i13]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-2106-15698
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2106-15698
Sergio Consoli, Luca Tiozzo Pezzoli, Elisa Tosetti:
Emotions in Macroeconomic News and their Impact on the European Bond Market. CoRR abs/2106.15698 (2021)
2019
[i12]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1903-01895
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1903-01895
Marijn van Knippenberg, Vlado Menkovski, Sergio Consoli:
Evolutionary Construction of Convolutional Neural Networks. CoRR abs/1903.01895 (2019)
[i11]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1906-02090
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1906-02090
Michael van Hartskamp, Sergio Consoli, Wim Verhaegh, Milan Petkovic, Anja van de Stolpe:
Artificial Intelligence in Clinical Health Care Applications: Viewpoint. CoRR abs/1906.02090 (2019)
2018
[i10]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1807-00566
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1807-00566
Sergio Consoli, Jan H. M. Korst, Gijs Geleijnse, Steffen Pauws:
On the minimum quartet tree cost problem. CoRR abs/1807.00566 (2018)
[i9]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1807-00570
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1807-00570
José Andrés Moreno-Pérez, Sergio Consoli:
Minimum Labelling bi-Connectivity. CoRR abs/1807.00570 (2018)
2017
[i8]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ConsoliKVHM17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ConsoliKVHM17
Sergio Consoli, Jacek Kustra, Pieter C. Vos, Monique Hendriks, Dimitrios Mavroeidis:
Towards an automated method based on Iterated Local Search optimization for tuning the parameters of Support Vector Machines. CoRR abs/1707.03191 (2017)
2016
[i7]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/RecuperoCCCGGLM16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/RecuperoCCCGGLM16
Diego Reforgiato Recupero, Mario Castronovo, Sergio Consoli, Tarcisio Costanzo, Aldo Gangemi, Luigi Grasso, Giorgia Lodi, Gianluca Merendino, Misael Mongiovì, Valentina Presutti, Salvatore Davide Rapisarda, Salvo Rosa, Emanuele Spampinato:
An Innovative, Open, Interoperable Citizen Engagement Cloud Platform for Smart Government and Users' Interaction. CoRR abs/1605.07343 (2016)
2015
[i6]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ConsoliMM15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ConsoliMM15
Sergio Consoli, Nenad Mladenovic, José A. Moreno-Pérez:
BVNS para el problema del bosque generador k-etiquetado. CoRR abs/1503.01376 (2015)
[i5]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ConsoliMM15a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ConsoliMM15a
Sergio Consoli, José Andrés Moreno-Pérez, Nenad Mladenovic:
Towards an intelligent VNS heuristic for the k-labelled spanning forest problem. CoRR abs/1503.02009 (2015)
[i4]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/Moreno-PerezC15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/Moreno-PerezC15
José A. Moreno-Pérez, Sergio Consoli:
On the Minimum Labelling Spanning bi-Connected Subgraph problem. CoRR abs/1505.01742 (2015)
[i3]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ConsoliM15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ConsoliM15
Sergio Consoli, José Andrés Moreno-Pérez:
An intelligent extension of Variable Neighbourhood Search for labelling graph problems. CoRR abs/1509.08792 (2015)
2014
[i2]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ConsoliRZ14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ConsoliRZ14
Sergio Consoli, Diego Reforgiato Recupero, Vanni Zavarella:
A survey on tidal analysis and forecasting methods for Tsunami detection. CoRR abs/1403.0135 (2014)
[i1]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ConsoliMDM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ConsoliMDM14
Sergio Consoli, José Andrés Moreno-Pérez, Kenneth Darby-Dowman, Nenad Mladenovic:
Mejora de la exploracion y la explotacion de las heuristicas constructivas para el MLSTP. CoRR abs/1405.1980 (2014)

Coauthor Index

see FAQ

manage site settings

To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.